Theopold!? tyoier
12 hours ago
Pridemoor Keep (Specter)
DUMB LAVA POTS !!!!
0 0
Theopold!? tyoier
12 hours ago
Pridemoor Keep (Specter)
Nooooooooooooo..... Falling down Premidoor...
0 0
Theopold!? tyoier
12 hours ago
Clockwork Tower (Specter)
Waaat? There can be this many sprites on screen in an 8 bit game!? I THINK NOT!
0 0
Theopold!? tyoier
12 hours ago
Clockwork Tower (Specter)
Ow ow owowowowowow! WOOWOWOWOW!...autoscroll is hard.
0 0
Theopold!? tyoier
13 hours ago
Tower of Fate (Specter)
I'm in charge of this minigame!
0 0
Theopold!? tyoier
13 hours ago
Tower of Fate (Specter)
Can you figure out the Black Screen? y fall
0 0
Theopold!? tyoier
13 hours ago
The Lich Yard
TOO MANY GHOSTS!
0 0
Pзdо Взar StayGraphic
16 hours ago
Stranded Ship
Fire Rod and a bit of extra magic makes this easy!
0 0
Isaac Labrynian_Rebel
21 hours ago
Village (Plague)
No dark arts or alchemy will save Miiverse from death :'(
0 0
Isaac Labrynian_Rebel
21 hours ago
Flying Machine (Specter)
No Miiverse for King Knight's campaign :(
0 0
hard haroldpaz32
23 hours ago
Fortaleza del Orgullo
hola?
0 0
Noor noorsaysWii
1 day ago
Pridemoor Keep
0 0
Dustin theKreifels
1 day ago
Pridemoor Keep
0 0
123 DarthV3434
1 day ago
The Lich Yard
0 0
GoodNhaw wolflunus
2 days ago
O Jardim do Espectro
Um boss mais difícil que o outro.
0 0
axel ponchitomx
2 days ago
Finca de Liches
No llueve senora
0 0
TK SinfulMelody
2 days ago
Plains
Goodbye forever miiverse! It was real.
0 0
Lilya Meow TheMoriartyFam
2 days ago
Explodatorium
that green castle is inposable
0 0
GoodNhaw wolflunus
2 days ago
Fortaleza de Brejorgulho
Foi difícil mais consegui! :)
0 0
Athena Theena
2 days ago
Flying Machine
I've only noticed now, Plauge of Shadows and Shovel of Hope have the same Miiverse posts!
0 0
Harrison WiiUthe3rd
2 days ago
Explodatorium
gg no re
0 0
Athena Theena
2 days ago
Clockwork Tower
This area reminds me the most of Mega Man.
0 0
Mama LaRosebud
2 days ago
Tower of Fate: Entrance
0 0
AlexParker bmcall3168
2 days ago
Tower of Fate (Specter)
how is miiversise going to die
0 0
Nixon 111111nixon
2 days ago
Frigid Flight
0 0
Nixon 111111nixon
2 days ago
Frigid Flight
0 0
KeganJ Kegan_Jacobs07
2 days ago
Village
Bye Miiverse ;(
0 0
Karry KarryLAM
2 days ago
Encounter - Reize (Plague)
I beat this so fast with Shovel Knight, but with plague knight it's just so hard
0 0
William mari02608
2 days ago
Lost City
0 0
Karry KarryLAM
2 days ago
The Lich Yard (Plague)
I forgot why i hated the Specter Knight boss battle...
0 0
Karry KarryLAM
2 days ago
Village (Plague)
I'm so pumped for King of cards!!!
1 0
Jay Diabolicalz
2 days ago
Plains
1 0
Jay Diabolicalz
2 days ago
Plains
1 0
BurgerDuck BurgerDuck
2 days ago
Plains
0 0
Daddy d.don3668
2 days ago
Plains
how do you do this
0 0
michael mikepaisis
3 days ago
Plains
how you get beat the first level of the blue knight with shovel
0 0
michael mikepaisis
3 days ago
Plains
0 0
Ethan edog26
3 days ago
Stranded Ship
this is bull
0 0
pixelplace pixelplace
3 days ago
Torre del Hado: Entrada
lol
0 0
Jon TGojiBoy15
3 days ago
Plains
Yes!
0 0
RonyStache RonyStache
3 days ago
Plains
i just shovel-bounced over that guy lol
0 0
RonyStache RonyStache
3 days ago
Plains
probobly my last post to miiverse. #RIPmiiverse
1 0
Tyler Supermariostar25
3 days ago
Plains
help
0 0
Ben luigiboy1000
3 days ago
Tower of Fate: ????
i beat the final final boss
0 0
Ben luigiboy1000
3 days ago
Tower of Fate: ????
if you don't knoe uou can defleft her fireballs
0 0
felibert felibert
3 days ago
Explodatorium
I love this game
0 0
Heath Adamic
3 days ago
Tower of Fate: Entrance
He got tougher
0 0
Heath Adamic
3 days ago
Flying Machine
Just bounce off his fencing thrusts
1 0
Heath Adamic
3 days ago
Stranded Ship
Toughest one yet
0 0
Heath Adamic
3 days ago
Lost City
That lava attack is nuts
1 0
lenny mauprat
3 days ago
Clockwork Tower (Specter)
i got 8/10 red skulls
0 0
ELI 77 ElijahCrenshaw
3 days ago
Plains (Specter)
THIS WHEN WAR BEGINS!
0 0
Heath Adamic
3 days ago
Lost City
Those are bridges. They look like holes.
0 0
mee shedevil123
11/03/2017 5:44 PM
Stranded Ship (Specter)
i currently hate the video game world, this game is so raging!
0 0
RiotAct RiotAct74
11/03/2017 2:47 PM
Plains (Specter)
This is one of the awesome feautures of Miiverse that will be missed! Miiverse is good Nintendo!
4 1
Noor noorsaysWii
11/03/2017 1:33 PM
Plains
im stuck fighting the black knight
1 0
Noor noorsaysWii
11/03/2017 1:26 PM
Plains
this game is savage
0 0
Angel wichopin
11/03/2017 10:14 AM
Campiña
Black Khing es mucho mejor
0 1
Dude 2 Jaden-Avner
11/03/2017 5:13 AM
Tower of Fate (Specter)
FEAT ACCOMPLISHED: SPIRIT OF GIVING!
3 0
Dude 2 Jaden-Avner
11/03/2017 4:15 AM
Plains (Specter)
He's like Knuckles & Modern Sonic! - Climbing & Homing Attacks!
0 0
Dude 2 Jaden-Avner
11/03/2017 4:08 AM
Plains (Specter)
The story begins!
0 0
Dude 2 Jaden-Avner
11/03/2017 2:44 AM
Village
FEAT ACCOMPLISHED: MUSIC LOVER!
0 0
Dude 2 Jaden-Avner
11/03/2017 1:56 AM
Tower of Fate: ????
I accomplished the "REFLECT LORD" FEAT!
0 0
Dude 2 Jaden-Avner
11/03/2017 12:03 AM
Tower of Fate: Entrance
Comment if you find this area. - Don't waste your Posts if they're limited though!
0 15
Dude 2 Jaden-Avner
11/03/2017 12:01 AM
Tower of Fate: Entrance
Go LEFT at the START.
0 0
Batman NoManSlend
11/02/2017 5:23 PM
The Lich Yard
cancer is good
0 0
ρк » мιкα Ellyzia
11/02/2017 1:16 PM
Pridemoor Keep (Specter)
this is annoyingggg,,
0 0
Wolfariel icatao
11/02/2017 3:11 AM
Village (Plague)
0 0
Paulo PAULOVILLICANA
11/01/2017 6:48 PM
Campiña
El Que Rie Al Último Rie Mejor, JEFE NOOB
1 0
Jonathan GojiKBooReaper
11/01/2017 5:17 PM
Plains
Sharpen thy shovel, and rescue your beloved Shield Knight.
1 0
Heath Adamic
11/01/2017 3:24 PM
Iron Whale
Treasure Knight is the best boss yet!
0 0
Heath Adamic
11/01/2017 2:58 PM
Encounter - Reize
What's with the fireball shield?
0 0
Heath Adamic
11/01/2017 2:55 PM
Explodatorium
eat it, plague knight
0 0
Pablo TheBMORandom
11/01/2017 2:20 PM
Villa
Como se corre alv ;v
0 0
€®Vϊñçéňт VJOSmith9
11/01/2017 10:42 AM
The Lich Yard (Specter)
MY NAME JEFF
0 0
Dude 2 Jaden-Avner
11/01/2017 3:40 AM
Tower of Fate: Entrance
I accomplished the "RELIC ROUNDTABLE" FEAT, using the PROPELLER DAGGER!
1 0
Dude 2 Jaden-Avner
11/01/2017 12:29 AM
Pridemoor Keep
Oh, rats! :P
0 0
Logan gninjas5
10/31/2017 6:34 PM
Plains
Slimes below.
0 0
matt Mattabrams21
10/31/2017 5:08 PM
Tower of Fate: ???? (Specter)
Happy Halloween
0 0
Mr. Doge:3 BeckettMCD
10/31/2017 1:33 PM
Encounter - Baz
Dead.
0 0
Mr. Doge:3 BeckettMCD
10/31/2017 1:25 PM
Encounter - Reize
0 0
dinoroar crisco-kids2
10/31/2017 12:30 PM
Pridemoor Keep (Specter)
0 0
William mari02608
10/31/2017 11:09 AM
Village
its dangerous to go alone take this [----|) #farewellmiiverse
3 0
Heath Adamic
10/30/2017 8:45 PM
The Lich Yard
Specter Knight is overrated
0 0
Heath Adamic
10/30/2017 8:19 PM
Pridemoor Keep
I didn't think I'd beat him! That was close!
0 0
Heath Adamic
10/30/2017 7:44 PM
Plains
Figured i should play this before the diggers`s diary disappears.
2 0
Jon nerdzilla
10/30/2017 7:00 PM
Tower of Fate: ????
I highly recommend dynamo armor.
0 0
max AllStarFish
10/30/2017 6:17 PM
Stranded Ship (Specter)
0 0
kyle bchinzi87
10/30/2017 4:57 PM
Tower of Fate: Ascent
1 0
LinkTheElf komixcreator
10/30/2017 3:38 PM
Tower of Fate (Specter)
bye friends mii verse is dead soon
3 1
kyle bchinzi87
10/30/2017 3:33 PM
The Lich Yard
yay i beat spectartor night
0 0
stanley stanimal51
10/30/2017 3:31 PM
Pridemoor Keep
LOL
1 0
mom xlfamily
10/30/2017 1:51 PM
The Lich Yard
THIS IS THE GERATEST GAME isn't it
1 0
Cam smithboysmom
10/30/2017 12:41 PM
Lost City
love the game
1 0
gamerp2003 gamerp2003
10/30/2017 11:40 AM
Tower of Fate: Entrance
I FINALLY BEAT BLACK KNIGHT I HATE HIM SO MUCH YAAAAAAAAAAA
0 0
boo 2.0 Booace
10/30/2017 8:51 AM
Village (Plague)
how do you watch all of monas dance moves
1 0
bb evan bbevan17
10/29/2017 6:33 PM
Tower of Fate (Specter)
0 0
kyle bchinzi87
10/29/2017 5:53 PM
Tower of Fate: Entrance
i am poooooop
0 0
kyle bchinzi87
10/29/2017 5:43 PM
Tower of Fate: Entrance
lol
0 0
itati julee1843
10/29/2017 4:56 PM
Plains (Plague)
0 0
Ben caroben590
10/29/2017 4:41 PM
Pridemoor Keep
Once upon a shoveled night, I slayed a dragon for it was right
1 0
Ryan onyx-birch11
10/29/2017 4:29 PM
Lost City (Specter)
hey xd
0 0
datmmaker nitrobot
10/29/2017 2:04 PM
Explodatorium (Specter)
too easy
0 0
Ashby Gamerop
10/29/2017 11:57 AM
Plains (Specter)
hi
1 0
LOGAN Luigi4mayor
10/29/2017 10:39 AM
Flying Machine (Specter)
wut do i do!!!!!!!!
0 0
LOGAN Luigi4mayor
10/29/2017 10:29 AM
Flying Machine (Specter)
Wut do we do!!!!!!!!!
0 0
LOGAN Luigi4mayor
10/29/2017 10:13 AM
Tower of Fate (Specter)
Wut do we do?
1 0
LOGAN Luigi4mayor
10/29/2017 9:21 AM
Plains (Specter)
1 0
LOGAN Luigi4mayor
10/29/2017 9:19 AM
Plains (Specter)
Yibe
1 0
Athena Theena
10/29/2017 7:40 AM
Village
Grandma Swamp: Double, trouble, soil and... Butt?
3 0
bb evan bbevan17
10/28/2017 9:04 PM
Troupple Pond
1 0
bb evan bbevan17
10/28/2017 8:57 PM
Troupple Pond
1 0
luca lucadoodle17
10/28/2017 8:49 PM
Plains
i wish you could play as other knights
1 0
M tdg228
10/28/2017 4:33 PM
Lost City
1 0
kyle bchinzi87
10/28/2017 4:25 PM
Tower of Fate: Entrance
lol
0 0
blake uahuff70
10/28/2017 3:40 PM
Lost City (Specter)
I feel bad for this guy
0 0
Adam Mrthugpug1732
10/28/2017 2:14 PM
Plains (Specter)
who else thinks that the propeller knight stage theme is the best
1 0
dirk ricefamily3
10/28/2017 1:40 PM
Dagger Dash
I wish I had my heli hat!
0 0
Zack Knight_of_Scyn
10/28/2017 12:20 PM
The Lich Yard
hi
0 0
Dude 2 Jaden-Avner
10/28/2017 11:53 AM
Plains
Nobody wanted to comment after facing the dragon that's clearly inspired by Mega Man's Yellow Devil?
2 0
Dude 2 Jaden-Avner
10/28/2017 11:43 AM
Plains
The first spikes in the game & I'm the first Dude to post here recently? - That's just weird!
0 0
gummy me64 CyclonicDuke
10/28/2017 11:40 AM
Tower of Fate: Ascent
1 0
gummy me64 CyclonicDuke
10/28/2017 11:00 AM
Tower of Fate: Ascent
1 0
Afton armydillo64
10/28/2017 10:46 AM
Plains
0 0
Dude 2 Jaden-Avner
10/28/2017 4:41 AM
Clockwork Tower
Good GEAR.
0 0
Dude 2 Jaden-Avner
10/28/2017 4:14 AM
Village
I've fully upgraded my MAGIC!
0 0
gummy me64 CyclonicDuke
10/27/2017 9:36 PM
Tower of Fate: Entrance
1 0
gummy me64 CyclonicDuke
10/27/2017 9:19 PM
Flying Machine
1 0
gummy me64 CyclonicDuke
10/27/2017 8:43 PM
Troupple Pond
1 0
dat guy megamario102
10/27/2017 6:24 PM
Iron Whale
is miiverse dying
0 0
Cole 2Cones
10/27/2017 6:09 PM
Plains (Specter)
cheats
1 0
Simon Danielic02
10/27/2017 4:47 PM
Pridemoor Keep (Specter)
rip miiverse lol
0 0
yoshi barryyokoyama
10/27/2017 3:34 PM
Iron Whale
ARRRGH! I KEEP DIEING ON THE TREASURE KNIGHT LEVEL
0 0
TERBLMJSTY TERRIBLE_MAJESTY
10/27/2017 2:49 PM
Plains
posting this while i still can...RIP MIIVERSE
7 0
Gold trainerGold1999
10/27/2017 2:12 PM
Plains
Playing with an SNES Classic controller! Too bad I don't have an NES Classic controller...
2 0
Zacky hellocutesheep11
10/27/2017 10:48 AM
Tower of Fate (Specter)
I can dance!
2 0
kyle bchinzi87
10/27/2017 10:07 AM
Clockwork Tower
noo
0 0
Dude 2 Jaden-Avner
10/27/2017 3:52 AM
Armor Outpost
I "NOW HOLD IN MY HANDS THE ULTIMATE SHOVEL BLADE."
0 0
Dude 2 Jaden-Avner
10/27/2017 3:47 AM
Knuckler's Quarry
I got my 27th song on the 27th!
0 0
Dude 2 Jaden-Avner
10/27/2017 3:00 AM
Armor Outpost
I just bought the final set of ARMOR on my second File!
0 0
Dude 2 Jaden-Avner
10/27/2017 2:09 AM
Lost City
The original is always best. Gotta go with Shovel Knight!
0 0
Errrk erickhve
10/27/2017 12:13 AM
Tower of Fate (Specter)
im gunna miss miiverse :`(
2 0
Dude 2 Jaden-Avner
10/26/2017 11:05 PM
Iron Whale
I'm playing with my brother, for the first time!
0 0
midoriya midoriya-kun
10/26/2017 8:01 PM
Finca de Liches (Specter)
0 0
midoriya midoriya-kun
10/26/2017 6:13 PM
Torre del Hado (Specter)
0 0
supersonic silvadow
10/26/2017 5:01 PM
Explodatorium (Specter)
Darkness/Will (Or "Dark Will" as I like to call it.) is annoying.
0 0
Beck Beckmala
10/26/2017 3:59 PM
Flying Machine (Specter)
this sucks
0 0
lennon LinkIn47
10/26/2017 2:59 PM
Stranded Ship
i can't wait for king of cards
0 0
Bich woodr84
10/26/2017 3:26 AM
Plains (Plague)
0 0
Dude 2 Jaden-Avner
10/25/2017 11:54 PM
Iron Whale
Good thing I had the FINAL GUARD Armor & some GOLD ICOR!
0 0
Dude 2 Jaden-Avner
10/25/2017 11:39 PM
Iron Whale
This is so Metroid!
0 0
Dude 2 Jaden-Avner
10/25/2017 11:26 PM
Encounter - Baz
Does this guy remind you of anyone?
0 0
Dude 2 Jaden-Avner
10/25/2017 11:06 PM
Armor Outpost
It's kinda weird to buy a BOSS fight in a store.
0 0
Dude 2 Jaden-Avner
10/25/2017 10:24 PM
Explodatorium
The CHAOS SPHERE seems to work on him...
0 0
Billy William2160
10/25/2017 6:49 PM
Plains
Fun game!!!
1 0
HJB da5baers
10/25/2017 5:49 PM
Village
2 1
Bro Bro dragonslayerxbro
10/25/2017 5:24 PM
Knuckler's Quarry
im a freaking goldfish
1 0
charlie tacocat522
10/25/2017 4:15 PM
The Lich Yard
when you have cheats its easy.
0 0
Dude 2 Jaden-Avner
10/25/2017 1:38 AM
Village
I entered the Butt code!!
0 0
Dude 2 Jaden-Avner
10/25/2017 1:04 AM
Pridemoor Keep
He said "Decadent Dandy"! lol!
0 0
Dude 2 Jaden-Avner
10/25/2017 12:28 AM
Troupple Pond
I imagine everyone in this game sounding like Travis Willingham's Thor... The guys anyway.
1 0
Dude 2 Jaden-Avner
10 hours ago
Plains
I am even more of a nave than I thought!
0 0
Dude 2 Jaden-Avner
10/24/2017 11:30 PM
Plains
Last I played I was nearing the end but due to long absence I am again but a nave!
0 0
liam lcphp123
10/24/2017 1:53 PM
Clockwork Tower
hi
1 0
Andrew Star_Wars_Fan021
10/24/2017 1:50 PM
Iron Whale
Why must this be sooo long????
1 0
Centi Zer0Pyr0
10/23/2017 8:20 PM
Armor Outpost
Suggestions for armor? #ShovelOfHope
1 0
Boss Man Caravan25
10/23/2017 7:49 PM
Iron Whale
whow Treasure Knight looks waaay different in body swap
2 0
Boss Man Caravan25
10/23/2017 7:17 PM
Pridemoor Keep
it even celibates with me
0 0
Boss Man Caravan25
10/23/2017 7:16 PM
Pridemoor Keep
mini shoves even cries when i die
1 0
Boss Man Caravan25
10/23/2017 6:57 PM
Pridemoor Keep
it even tries so hard to fight with me
1 0
Boss Man Caravan25
10/23/2017 6:55 PM
Pridemoor Keep
this fairy is adorable it tries so hard to dig and pick up jewels
1 0
oculus oculus12905
10/23/2017 3:05 PM
Tower of Fate: ???? (Plague)
Be free dragon balls! FREE!!!!
1 0
raul ramp16
10/23/2017 1:44 PM
Iron Whale
saludos terricolas
1 0
cooster yokaidude
10/23/2017 11:15 AM
Plains
no!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
1 0
cooster yokaidude
10/23/2017 11:06 AM
Plains
save shield knight
1 0
Cody MammothMan3
10/22/2017 8:16 PM
Village
Onward brave knights of the digger's blade, onward to shovel themed adventure!
1 0
lol Charlie837
10/22/2017 7:45 PM
Pridemoor Keep
i fought king butt love this cheat code it is x&butt
0 0
Cameon superfast88
10/22/2017 5:47 PM
Tower of Fate: Entrance
0 0
Cameon superfast88
10/22/2017 5:45 PM
Tower of Fate: Entrance
0 0
Cameon superfast88
10/22/2017 5:42 PM
Tower of Fate: Entrance
0 0
blkSnkMoan blkSnakeMoan
10/22/2017 4:54 PM
Pridemoor Keep (Specter)
this Level is so hard ar
0 0
Michael tigger4665
10/22/2017 2:34 PM
Troupple Pond
2 0
Lary EVAN_K1234
10/22/2017 1:58 PM
Pridemoor Keep
died to a knight thats a king[thinks] Wait how was that knight a king?!!?!?!:
1 0
Ben tablemonkey
10/22/2017 10:24 AM
The Lich Yard
0 0
robbins jacksboy1
10/22/2017 10:16 AM
The Lich Yard (Plague)
just stand in the left corner a n throw bounce bombs. done
0 0
MOLLY cutiepie538
10/22/2017 9:06 AM
Plains (Plague)
typo about an Butt (Farting)
1 0
thomas raisor3019
10/22/2017 8:58 AM
The Lich Yard
this game is hard!!!!!!!!!!!!
0 0
neek neek47
10/22/2017 8:22 AM
The Lich Yard (Plague)
0 0
ker-plop ker-plop
10/21/2017 8:20 PM
Village
Fare thee well, Miiverse! Adventure onward, brave knights!
1 0
robbins jacksboy1
10/21/2017 5:46 PM
Troupple Pond
1 0
InkShooter JackWilly1
10/21/2017 11:41 AM
Tower of Fate (Specter)
specter knights best friends
0 0
Ty kingtyler22
10/21/2017 9:31 AM
Plains
0 0
juan jose juanjoseva
10/21/2017 7:42 AM
Village
aaaaaaaaaaaazzaaacxfdvfgcuffrfdfbkhkhzjjgjhkbhkkjgghhhdfzydd
3 0
Beck Beckmala
10/21/2017 6:53 AM
Iron Whale
i cant beet this mini boss
1 0
charlie cfirefly
10/21/2017 6:18 AM
Plains (Specter)
...
0 0
SOOBY!!!!! davidvr4
10/21/2017 5:45 AM
Plains
0 0
Maddox Maddox-R
10/20/2017 8:01 PM
Explodatorium (Specter)
didnt take damage
0 0
Maddox Maddox-R
10/20/2017 8:00 PM
Explodatorium (Specter)
Why is Plague Knight sooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo easy
0 0
Maddox Maddox-R
10/20/2017 7:32 PM
Pridemoor Keep (Specter)
0 0
Maddox Maddox-R
10/20/2017 7:27 PM
Pridemoor Keep (Specter)
y is specter easier than shovel knight?
0 0
Thomas snakethegreat
10/20/2017 5:58 PM
Plains (Plague)
skeet
0 0
Kc kc2011
10/20/2017 3:04 PM
Plains
dead
0 0
Maddox Maddox-R
10/19/2017 6:08 PM
Tower of Fate (Specter)
You can unlock Donovan mode by collecting every Music Sheet, all Red Skulls, and all Shadow Coins ;)
2 0
Maddox Maddox-R
10/19/2017 5:44 PM
Iron Whale (Specter)
If I do say! This game really DUSTS MY DOILIES!
0 0
YatoG91 basaldu75
10/19/2017 5:22 PM
Plains
0 0
EVY NHDinoblockgirl
10/19/2017 2:26 PM
Tower of Fate (Specter)
0 0
Fisher fishersno45
10/19/2017 5:29 AM
Troupple Pond
2 0
Lionheart3 NeelPastel27
10/18/2017 7:21 PM
Torre del Hado: ????
Final del juego estoy feliz.
4 0
gutico gutico1983
10/18/2017 4:11 PM
Village
Great Game
3 0
mark bkjm87
10/18/2017 4:08 PM
Plains
mark
0 0
Brock MiracleMatter
10/18/2017 6:39 AM
Village (Plague)
0 0
Brock MiracleMatter
10/18/2017 6:27 AM
Village (Plague)
just finished plague knight!
0 0
prince☆ takumemer
10/17/2017 7:33 PM
Explodatorium (Plague)
the explodatorium is brutal, send help
0 0
mom Lbergerfamily406
10/17/2017 1:14 PM
Plains (Plague)
0 0
Athena Theena
10/17/2017 12:59 PM
Flying Machine (Plague)
I was doing the death animation about to explode, but then I just got up and got the essence!
1 0
Lionheart3 NeelPastel27
10/16/2017 6:22 PM
Explotatorium
Mundo 4 Derrotado.
2 0
Lionheart3 NeelPastel27
10/16/2017 5:26 PM
Fortaleza del Orgullo
Tercer mundo derrotado.
1 0
Lionheart3 NeelPastel27
10/16/2017 4:54 PM
Finca de Liches
Derrotado segundo mundo.
1 0
Micah MacGames
10/16/2017 4:50 PM
Plains
0 0
Gavin Griff_Trooper
10/16/2017 3:57 PM
Plains (Specter)
0 0
Lionheart3 NeelPastel27
10/16/2017 3:24 PM
Campiña
Jugando un nuevo juego.
1 0
Izekial Izekial4427
10/16/2017 1:40 PM
The Lich Yard (Specter)
That room was hard!
0 0
ky GO gaming-O
10/16/2017 10:37 AM
Iron Whale
0 0
ky GO gaming-O
10/16/2017 10:36 AM
Iron Whale
0 0
Pouhi Kiy0nTao
10/16/2017 3:21 AM
Stranded Ship
0 0
Kash SsbFanSmlBoi4600
10/16/2017 1:51 AM
The Lich Yard (Specter)
this game kicks my face to the point where my skull is broken, but I made it to Game+ with them all!
1 0
ngnog ModdingNoob
10/15/2017 7:43 PM
The Lich Yard
im u moom lich
0 0
Cesar AnGorDeV
10/15/2017 6:16 PM
La Ciudad Perdida
0 0
Eve TrishaElric
10/15/2017 5:17 PM
The Lich Yard
0 0
zackattack thrashkid
10/15/2017 5:10 PM
Tower of Fate: Entrance (Specter)
0 0
zackattack thrashkid
10/15/2017 4:55 PM
Tower of Fate (Specter)
0 0
zackattack thrashkid
10/15/2017 4:22 PM
Clockwork Tower (Specter)
0 0
Carter weegie214
10/15/2017 10:51 AM
Pridemoor Keep
money and a meal
0 0
Carter weegie214
10/15/2017 10:48 AM
Pridemoor Keep
that throne tho @–@
0 0
Mr.France★ SaunoBros
10/15/2017 10:39 AM
Pridemoor Keep (Specter)
1 0
Mr.France★ SaunoBros
10/15/2017 10:36 AM
Pridemoor Keep (Specter)
It is fun and hard (:
0 0
Carter weegie214
10/15/2017 10:36 AM
Pridemoor Keep
go left at the start and dig the wall
1 0
adam d JoeyMan77
10/15/2017 9:25 AM
Tower of Fate (Specter)
vhjcx
0 0
daboy DaBoy2
10/15/2017 9:23 AM
Plains
i love this game
0 0
The Jeffy SSB448
10/14/2017 11:54 PM
Flying Machine (Specter)
I have no words.
0 0
The Jeffy SSB448
10/14/2017 11:19 PM
Lost City (Specter)
He's so easy. And kinda dumb.
0 0
The Jeffy SSB448
10/14/2017 11:17 PM
Lost City (Specter)
Plague of Shadows is the best. The end of level music though.
0 0
Swagkot danielitomayorga
10/14/2017 7:57 PM
Fortaleza del Orgullo
0 0
Brock MiracleMatter
10/14/2017 7:15 PM
Village (Plague)
just started plague knight! I've already finished Shovel Knight and Specter Knight :D
0 0
maicra angelgamernitti
10/14/2017 6:53 PM
Hall of Champions
yo se que en este lugar se lucha con kratos alguien me dice como
0 0
Keaton keatonandmomma
10/14/2017 6:46 PM
Clockwork Tower
Im beating up a baby OH NO!
1 0
Keaton keatonandmomma
10/14/2017 4:55 PM
Flying Machine
U theyjuniorjourney
0 0
Keaton keatonandmomma
10/14/2017 3:02 PM
Clockwork Tower
I will defeat u Black Knight
0 0
Christian CM90110
10/14/2017 1:15 PM
The Lich Yard (Plague)
wow
0 0
Zacky hellocutesheep11
10/14/2017 1:04 PM
Iron Whale
gg ez pz wy 2 ez
0 0
Modifly ModiflyHellfire
10/14/2017 11:53 AM
Village (Plague)
0 0
JR junior361
10/13/2017 9:04 PM
Encounter - Phantom Striker
getting pretty far on new game +!
0 0
Clark Clark828
10/13/2017 7:05 PM
Clockwork Tower
DESTROYED HIM WITH ONLY ONE HEART!!!!
0 1
jonathan jonathancio
10/13/2017 6:51 PM
Plains (Specter)
0 0
Friki Freekvius
10/13/2017 5:57 PM
La Ciudad Perdida
0 0
luca lucadoodle17
10/13/2017 4:03 PM
Troupple Pond (Plague)
hi
0 0
Isaac IkeVonIsaac
10/13/2017 3:43 PM
Plains
0 0
doop AndrewJackson
10/13/2017 2:20 PM
Tower of Fate (Specter)
That was a difficult challenge, but I completed it!
0 0
Mr.random MrRandom1222
10/13/2017 2:13 PM
Tower of Fate (Specter)
0 0
Zacky hellocutesheep11
10/11/2017 6:57 PM
Explodatorium (Plague)
How does he have the horn?
0 0
ShadowF127 QSummit1
10/11/2017 5:54 PM
Explodatorium
Absoulute B.S
0 0
isaac IsaacA2005
10/11/2017 3:34 PM
Flying Machine (Specter)
just use the coin and jump slice
0 0
isaac IsaacA2005
10/11/2017 3:24 PM
Flying Machine (Specter)
f..k the level ps it is vary hard
0 0
bakardy ikercito5
10/11/2017 12:55 PM
Fortaleza del Orgullo
@S@ÑSÑ
0 0
Lewis UncleLewBag
10/11/2017 10:23 AM
Anchors Aweigh
0 0
Rymanjones Rylan44
10/11/2017 7:26 AM
Tower of Fate: ????
Soooooooooo hard P.S. Get two red trouple chalices!
0 0
ShadowF127 QSummit1
10/10/2017 6:28 PM
The Lich Yard
Specter Knight is epic
1 0
will LegoMasterJedi
10/10/2017 4:33 PM
Village
R.I.P. Miiverse
3 0
Jesse jessephonephone
10/09/2017 5:33 PM
Iron Whale
I Want To Become One Of The Green Fish Enemys, And Disapear.
0 0
ShadowF127 QSummit1
10/09/2017 4:58 PM
Explodatorium (Specter)
Screw plague knight
0 0
Cranky legendofgood
10/09/2017 4:41 PM
Plains (Specter)
0 0
Zacky hellocutesheep11
10/09/2017 3:30 PM
Explodatorium (Plague)
Traitor!
0 0
Alex trolllception
10/09/2017 9:18 AM
Plains
i need to beat game
1 0
zackattack thrashkid
10/09/2017 9:06 AM
Explodatorium (Plague)
THIS IS SO HARD!!!!!
1 0
JR junior361
10/09/2017 12:56 AM
Tower of Fate (Specter)
just finished specter of torment!
1 0
James GuyRestsOnSSofa
10/09/2017 12:10 AM
Tower of Fate (Specter)
3 0
James GuyRestsOnSSofa
10/08/2017 11:52 PM
Explodatorium (Specter)
This room has a secret entrance to the whisp. It took way too many tries to find it.
0 0
Zacky hellocutesheep11
10/08/2017 6:08 PM
Tower of Fate: Entrance (Specter)
This section is TERRIBLE
0 0
Tristin vadersjester
10/08/2017 5:38 PM
Lost City (Specter)
All The Music In Specter Of Torment Is Better than Shove Knights
0 0
PL1 barrettbros
10/08/2017 5:13 PM
Plains (Specter)
0 0
zackattack thrashkid
10/08/2017 7:44 AM
Tower of Fate: ????
please tell me how to kill her!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
0 0
T-Dex pletcher4
10/08/2017 7:02 AM
Tower of Fate (Specter)
2 0
Nathaël Kuroko9753
10/07/2017 8:14 PM
Plaines (Plague)
cest trop kool
0 0
christian csp806
10/07/2017 7:12 PM
Plains
1 0
Mikey Stickmenrul47
10/07/2017 3:47 PM
Forest of Phasing
With a friend or brother, don't kill eachother over some food or magic or gold
2 0
bertildo megameno
10/07/2017 11:55 AM
Baleia de Ferro
Jogo Top!!!
0 0
kindledude TeamPhillips06
10/07/2017 11:45 AM
Plains
If u use code JFFQWOJV u will turn into the shovel god!!!
1 0
Tony tonymanmario
10/07/2017 11:44 AM
The Lich Yard
gay
1 0
Nikki aranennis
10/07/2017 7:51 AM
Village
I have a fake youtube channel with my sister!
0 0
oculus oculus12905
10/07/2017 7:38 AM
Tower of Fate: Entrance (Plague)
bait bombs will work wonders when hes on the ground
0 0
Sean Sean14520
10/07/2017 7:34 AM
Plains (Specter)
Not that hard, just know when to use a ground slash and when to use a dash slash.
0 0
oculus oculus12905
10/07/2017 7:14 AM
Tower of Fate: Entrance (Plague)
0 0
bob childless
10/07/2017 7:05 AM
Flying Machine (Specter)
i love this game
0 0
Chris spunk1910
10/07/2017 6:47 AM
Pridemoor Keep
0 0
coolkid775 iannacofamily5
10/07/2017 4:45 AM
Plains
0 0
Pinky y2kohlhagen
10/06/2017 5:18 PM
Plains
3 0
Xavier kyzlix
10/06/2017 4:11 PM
Plains
i have a lv 50 ambow
1 0
J.V :) bdog2015
10/06/2017 3:52 PM
Torre del Hado (Specter)
0 0
Lil Conner billybongbongo
10/06/2017 2:50 PM
The Lich Yard
i bought this...
0 0
Imswag688 SansSkeleton13
10/06/2017 1:49 PM
Plains
Black Knight fight on a new shovel knight save.
2 0
gbill gbillinger123
10/06/2017 10:55 AM
Tower of Fate (Specter)
RIP miiverse .who knows when - Nov 7 2017
3 1
Jared jlsczr
10/05/2017 12:24 PM
Pridemoor Keep
Just Started Playing :)
1 0
Pentaro Pentarillo
10/05/2017 10:43 AM
Tower of Fate: Entrance
2 0
Pentaro Pentarillo
10/05/2017 10:20 AM
Flying Machine
1 0
Zacky hellocutesheep11
10/04/2017 3:08 PM
Rematch: Enchantress
Thou can reflect the projectiles!
0 0
Alexander FORCA_TATICA
10/04/2017 11:38 AM
Máquina Voadora (Specter)
PORQUE VENTILADORES NÃO JETEPÉKI DIZENDO A VERDADE EU PREFERIA JETEPÉKI PORQUE EU GOSTO DE JETEPÉKI
0 0
SrPiggyx3 CoolPig03
10/03/2017 6:53 PM
Torre del Hado: ???? (Specter)
La batalla final... Es el momento de darlo todo!!
0 0
oculus oculus12905
10/03/2017 2:01 PM
Stranded Ship (Plague)
component, float, and quick is the ultimate wolf troller
0 0
oculus oculus12905
10/03/2017 1:57 PM
Flying Machine (Plague)
componet powder, float casing, and quick fuse work wonders
0 0
oculus oculus12905
10/03/2017 1:54 PM
Flying Machine (Plague)
now i hate propeller knight twice as much
0 0
sage ice lavanadams
10/03/2017 6:40 AM
Plains
Almost to the end of shovel knite world!!
1 0
Charlie™ gullommartini
10/02/2017 3:14 PM
Plains
soo hard im about to cry
1 0
Charlie™ gullommartini
10/02/2017 3:05 PM
Plains
really fun!
1 0
Nate Njmath
10/02/2017 2:26 PM
Village
What am i doing with my life?
1 0
Harry Novawesome
10/02/2017 2:07 PM
Tower of Fate (Specter)
wait so in new game plus your health deplets in your base?!? WHaT THE HeCK
3 0
Lucas Khasmordan
10/02/2017 1:31 PM
Iron Whale
defete the killer
0 0
Cannon cannonballjack
10/02/2017 11:42 AM
Iron Whale
#Redknight
0 0
ExleyToast Ianexle
10/01/2017 8:12 PM
Plains
waaaz upp
1 0
coolboymew cool_boy_mew
10/01/2017 2:17 PM
Plains (Specter)
Air comboing that Dragon was awesome
0 0
Eze efa682
10/01/2017 12:06 PM
The Lich Yard
didn't stand a ghost of a chance
1 0
tj'sgreat tjsgreat
10/01/2017 10:19 AM
Tower of Fate (Specter)
goodbye everybody i will miss all of u guys so much u guys have helped through tough times thank u
6 0
tj'sgreat tjsgreat
10/01/2017 10:19 AM
Tower of Fate (Specter)
well guys since miiverse is shutting down i wanted to say goodbye ive had a great time with all of u
3 0
marcus dld0622
10/01/2017 6:58 AM
The Lich Yard
yay
0 0
gav GavGamer10
09/30/2017 7:32 PM
Plains (Specter)
I can't get past this level!!!!
1 0
David blueberry34389
09/30/2017 4:09 PM
Tower of Fate: Entrance
Way to easy.
0 0
Eze efa682
09/30/2017 12:52 PM
Plains
first time playing, and i love it
2 0
luca lucadoodle17
09/30/2017 10:16 AM
Village (Plague)
word to the wise: plauge knight`s float casting sentery fuse and ignition powder is a perfect combo!
0 0
oculus oculus12905
09/30/2017 6:41 AM
Plains (Plague)
0 0
kyle adenjohn05
09/29/2017 9:36 PM
Troupple Pond (Plague)
tinker knight for life
0 0
kyle adenjohn05
09/29/2017 9:29 PM
Village (Plague)
hey guys tinker kight ls the best
2 0
kai taj mjday44
09/29/2017 2:35 PM
Flying Machine
0 0
oculus oculus12905
09/29/2017 2:19 PM
Plains (Plague)
WHY DIDNT I PLAY THIS EARLIER!
2 0
Jacob NinjagoJacob09
09/29/2017 12:27 PM
Pridemoor Keep (Plague)
1 0
Blizan ldwully
09/29/2017 12:15 PM
Tower of Fate (Specter)
Loving this game
2 0
GrumPato watya19
09/29/2017 5:53 AM
Village (Plague)
miverse no more
1 0
Andy LUBUofDW
09/28/2017 9:24 PM
Stranded Ship (Specter)
is this still working
0 0
Jimmy kongdonkey622
09/28/2017 6:13 AM
Village
I HAVE 14988 GOLD IN SHOVEL KNIGHT MODE!!!!!
0 0
ian imathe
09/27/2017 2:45 PM
Pridemoor Keep
0 0
LWP knightofspace13
09/27/2017 2:23 PM
Lost City (Specter)
best game mode
0 0
Mii Rick FlogginMcMurry
09/27/2017 9:28 AM
Explodatorium
Don't forget your PHASE LOCKET
1 0
cadblur cadblur
09/27/2017 4:42 AM
The Lich Yard
CCVJJVJJXFGFFJHFFFFGFIOGIGOJKLBFBOP
1 0
ACE FOXTROTTM2.0
09/26/2017 7:23 PM
Pridemoor Keep
1 0
Maddox Maddox-R
09/26/2017 6:28 PM
Plains (Plague)
I AM A BIRD.
1 0
Blobfish Kdoubleh
09/26/2017 6:23 PM
Lost City (Plague)
smh this boss isn't even hard
0 0
lgcrsbfsva lealexlealex
09/26/2017 6:17 PM
Finca de Liches
ya lo mate
0 0
Maddox Maddox-R
09/26/2017 3:51 PM
Iron Whale
Treasure Knight stage might be the bane of my existence
2 1
Harry Novawesome
09/26/2017 2:41 PM
Tower of Fate: Entrance (Specter)
HECCCCCCCCC YEEEEEEEAAAAHHH
0 0
oculus oculus12905
09/26/2017 12:55 PM
Tower of Fate: ????
im pretty sure this is impossible
1 0
vee veeseaba
09/25/2017 5:47 PM
Village
jouer en coop sa trup le sul
0 0
MrsPancake McMuffins_JTVC
09/25/2017 5:28 PM
Pridemoor Keep
oh godness :v
0 0
Maddox Maddox-R
09/25/2017 3:56 PM
Village
just beat the reaper knight or whatever and got that blue heart thingy
3 0
Sisyphus hatallam
09/25/2017 3:06 PM
Village
start a new file and type in x&butt for a cheat code
2 0
oculus oculus12905
09/25/2017 1:03 PM
Tower of Fate: Entrance
WHY BLACK KNIGHT WHY!!!!
1 0
William William113262
09/25/2017 12:31 PM
Armor Outpost
new gear
1 0
oculus oculus12905
09/25/2017 12:30 PM
Tower of Fate: Entrance
YASSSSSSS SECOND CHECKPOINT
0 0
oculus oculus12905
09/25/2017 12:21 PM
Tower of Fate: Entrance
Darn griffon! y u so hard!
0 0
Britton mudkipbritton
09/25/2017 5:51 AM
Pridemoor Keep
RIP Miiverse!
2 0
Sanio SonioExpert
09/24/2017 7:03 PM
Plains
There's 2 walls you can break in here!
1 0
BRad BABOOMBA
09/24/2017 2:52 PM
Pridemoor Keep (Plague)
0 0
Bruce Jr bruce-can-draw
09/24/2017 2:49 PM
Tower of Fate: Ascent
0 0
BRad BABOOMBA
09/24/2017 2:45 PM
Pridemoor Keep (Plague)
0 0
Improviser improviserPAT
09/24/2017 2:30 PM
Village
3 0
BRad BABOOMBA
09/24/2017 1:15 PM
Pridemoor Keep (Plague)
0 0
gracen JackGracen
09/24/2017 12:55 PM
Iron Whale
how do you beat mid boss!?!?!?!?
0 0
☆EMR☆ smashmallow101
09/24/2017 12:52 PM
Tower of Fate (Specter)
lol rail mail 2 much style so 1337
1 0
sage ice lavanadams
09/24/2017 10:14 AM
Plains
i hope dis game does not end soon
0 0
EGGHEAD EGGHEAD4
09/24/2017 10:14 AM
Tower of Fate: ????
is is so hard to get past the blocks that come attack you
0 0
sage ice lavanadams
09/24/2017 10:13 AM
Plains
i got a lot done ...
0 0
sage ice lavanadams
09/24/2017 10:12 AM
Plains
WAT?!
0 0
sage ice lavanadams
09/24/2017 10:09 AM
Plains
I KEEPS DIEING
1 0
RK☆ dom dbarabuscio
09/24/2017 10:05 AM
Plains
Finally
3 4
★♀¤∞±←˙–•★ 1945CFam
09/24/2017 9:03 AM
The Lich Yard
I look at this level in disgrace.
0 0
Athena Theena
09/24/2017 8:34 AM
Armor Outpost (Plague)
Man I love the butt cheat code!
0 0
Athena Theena
09/24/2017 8:26 AM
Explodatorium (Plague)
This has the same comments from the Shovel of hope!
1 0
Athena Theena
09/24/2017 8:21 AM
Explodatorium (Plague)
I don't know why but this feels familiar...
1 0
Athena Theena
09/24/2017 8:20 AM
Explodatorium (Plague)
Wow I have a lot of masks.
0 0
Athena Theena
09/24/2017 6:58 AM
Village (Plague)
I am doctor butt!
0 0
Maddox Maddox-R
09/23/2017 7:36 PM
Pridemoor Keep
JUST BEAT KING KNIGHT
2 0
Maddox Maddox-R
09/23/2017 7:08 PM
Plains
Just beat black knight... soooooo hardddd
0 0
Clark Clark828
09/23/2017 7:03 PM
Clockwork Tower
OMG he made a robot!!!
0 0
Caleb thefrazemaker
09/23/2017 7:00 PM
The Lich Yard (Plague)
man is speacter knight easy to beat as plauge knight
0 0
Aldrich Aldrich.exe
09/23/2017 5:29 PM
La Ciudad Perdida
#Modo plus+
0 0
gracen JackGracen
09/23/2017 4:15 PM
Explodatorium
why is this game a rage game?
1 0
holly e raleighm3
09/23/2017 4:03 PM
Plains
0 0
holly e raleighm3
09/23/2017 4:01 PM
Plains
3 0
Stevie SonicReaction
09/23/2017 3:45 PM
Plains (Plague)
hiiiii
1 0
Santino C santinobeeno
09/23/2017 2:43 PM
Plains (Specter)
hate
1 0
Chris Hegs75
09/23/2017 7:29 AM
Explodatorium
2 0
Chris Hegs75
09/23/2017 7:27 AM
Explodatorium
two words,SO HARD!!!!!!!!!
1 0
Athena Theena
09/23/2017 6:51 AM
Tower of Fate: Ascent
My game crashed last time when I was in this room and I had to do the whole level again...
0 0
Athena Theena
09/23/2017 6:37 AM
Tower of Fate: Ascent
I died over here... How did I even do that?
0 0
Jake mr.awewome365
09/22/2017 11:22 PM
The Lich Yard
cant beat spector knight!!
0 0
two face Alexrocksmore
09/22/2017 3:01 PM
Tower of Fate: Ascent
easy peasy lime hand
1 0
kyle martinkyka
09/22/2017 2:42 PM
Explodatorium
i cant etheir
0 0
oculus oculus12905
09/22/2017 12:12 PM
Village
wow ive died 151 times
0 0
oculus oculus12905
09/22/2017 12:10 PM
Village
HEY YOU WATCH ME DANCE
0 0
oculus oculus12905
09/22/2017 12:07 PM
Troupple Pond
7 0
chris babyboy121
09/22/2017 10:50 AM
Tower of Fate: Entrance
i have cheats still hard
0 0
Jimmy kongdonkey622
09/22/2017 6:48 AM
Armor Outpost
i just beat the entrance of THE TOWER OF FATE.
0 0
oculus oculus12905
09/22/2017 5:34 AM
Tower of Fate: Entrance
1 0
oculus oculus12905
09/22/2017 5:32 AM
Tower of Fate: Entrance
1 0
andres Tomatoman134
09/21/2017 6:04 PM
Plains
this game is so lit
1 0
derp ch1huahua80
09/21/2017 5:07 PM
Iron Whale
I agree with you
0 0
Athena Theena
09/20/2017 6:30 PM
Clockwork Tower (Specter)
Wow this fight was eas- OH COME ON!
0 0
Athena Theena
09/20/2017 5:13 PM
Iron Whale (Specter)
"Oh this is to good to be true!" I said. Turns out it IS to good to be true. :(
0 0
Jamie juliemitchell10
09/20/2017 4:50 PM
Plains (Plague)
tdx
1 0
Adam Mrthugpug1732
09/20/2017 4:01 PM
Tower of Fate (Specter)
3 0
Athena Theena
09/20/2017 3:44 PM
Pridemoor Keep (Specter)
As soon as I beat king knight I fell into the pit. At least I won?
0 0
Wobbly feelinwobbly
09/20/2017 2:34 PM
The Lich Yard
There is a Specter haunting Europe. The specter of communism.
0 0
dudeguy beembo.net
09/20/2017 1:04 PM
Plains
k
0 0
Alexandre amarinho1113
09/19/2017 10:17 PM
Memória da aventura (Specter)
0 0
sage ice lavanadams
09/19/2017 6:39 PM
Village
mole knight,u r goin dowwwwwn!!!
2 0
julio link7700
09/19/2017 6:20 PM
Torre del Hado: Entrada (Plague)
me estoy pasando el juego en modo difisil XD
0 0
Phil rambo8080
09/19/2017 4:12 PM
Plains (Plague)
Mona not Magicist
0 0
Phil rambo8080
09/19/2017 4:11 PM
Plains (Plague)
hard to use though
0 0
MaxMann GamGam88
09/19/2017 3:33 PM
Pridemoor Keep
Wow Level 2 Is Hard wow
0 0
Phil rambo8080
09/19/2017 3:22 PM
Iron Whale (Plague)
finally
0 0
HISOk AlvarToons
09/19/2017 2:49 PM
Villa
¡Fua chaval! Esto es nuevo para mi.
1 0
★$legend$★ legend1317
09/18/2017 5:47 PM
Clockwork Tower
i beet the gam and i am restard the game
3 0
Yoshi Fan yoshi_fan_ftw
09/18/2017 5:33 PM
Tower of Fate: ????
0 0
Yoshi Fan yoshi_fan_ftw
09/18/2017 5:26 PM
Tower of Fate: ????
its go time
0 0
Yoshi Fan yoshi_fan_ftw
09/18/2017 5:18 PM
Armor Outpost
Enchantress, here I come!!!
0 0
Yoshi Fan yoshi_fan_ftw
09/18/2017 5:14 PM
Tower of Fate: Ascent
that moment when you first try the boss rush
0 0
Yoshi Fan yoshi_fan_ftw
09/18/2017 4:25 PM
Tower of Fate: Entrance
0 0
Yoshi Fan yoshi_fan_ftw
09/18/2017 4:22 PM
Tower of Fate: Entrance
i hate this part
0 0
lgcrsbfsva lealexlealex
09/18/2017 3:46 PM
Villa
hola soy nuevo
0 0
Kyle169 KHCHerobrine1
09/18/2017 3:45 PM
Plains
stupid boss remaches
1 0
Jamie juliemitchell10
09/18/2017 3:07 PM
Plains (Plague)
f
1 0
Danny thenumber122
09/17/2017 6:32 PM
Flying Machine (Specter)
0 0
BeleT. ladytournesol
09/17/2017 5:34 PM
Plains (Plague)
0 0
Yoshi Fan yoshi_fan_ftw
09/17/2017 4:27 PM
Flying Machine
it must be hard to get to your secret base if you have to do this much platforming to get there.
1 0
Yoshi Fan yoshi_fan_ftw
09/17/2017 3:54 PM
Clockwork Tower
screw tinker knight
0 1
Coolcam200 coolcam1274
09/17/2017 3:29 PM
Hall of Champions
Ghost? They ain't hard to kill.
1 0
Yoshi Fan yoshi_fan_ftw
09/17/2017 3:27 PM
Stranded Ship
frick you polar knight
0 0
Yoshi Fan yoshi_fan_ftw
09/17/2017 3:12 PM
Stranded Ship
fu polar knight
0 0
Yoshi Fan yoshi_fan_ftw
09/17/2017 3:09 PM
Stranded Ship
i need to be able to fly
1 0
ice qwople
09/17/2017 2:58 PM
Flying Machine
used the warhorn
0 0
Elijah coolioe12
09/17/2017 2:43 PM
Tower of Fate: ???? (Specter)
mario called he wants his trap back
1 0
chloe unicorncurry
09/17/2017 2:02 PM
The Lich Yard
the enchantress is very pretty
1 0
chloe unicorncurry
09/17/2017 2:01 PM
The Lich Yard
specter knight is so hard to beatttt
0 0
Montigusta ambereyedleaf
09/17/2017 12:53 PM
Iron Whale
My last report b4 miiverse dies. Fare thee well all.
0 0
sam wiz689
09/17/2017 10:08 AM
Plains
help
0 0
Griff Cowbiscuit
09/17/2017 10:01 AM
Iron Whale
Boom I killed it
0 0
Griff Cowbiscuit
09/17/2017 9:57 AM
Iron Whale
yes checkpoint
0 0
luca lucadoodle17
09/17/2017 9:56 AM
Tower of Fate: ???? (Specter)
just started playing, cool game
0 0
Griff Cowbiscuit
09/17/2017 9:37 AM
The Lich Yard
DED :)
0 0
Griff Cowbiscuit
09/17/2017 9:33 AM
The Lich Yard
0 0
Griff Cowbiscuit
09/17/2017 9:03 AM
Pridemoor Keep
EZ
2 0
Griff Cowbiscuit
09/17/2017 8:55 AM
Pridemoor Keep
At the king knight's area. Wish meh luck
1 0
Jude jude1337
09/17/2017 8:19 AM
Plains
hello
0 0
Lilya Meow TheMoriartyFam
09/17/2017 7:08 AM
Plains
i got 10229 gold! im getting even more! any way, what's the maximum gold you can get?!?! i want to!!
0 0
Liam notluigi2011
09/17/2017 5:25 AM
Iron Whale (Specter)
0 0
Collin JCollin25
09/16/2017 10:44 PM
Stranded Ship
kill all black
0 0
cm lukejames6
09/16/2017 10:26 PM
Plains (Plague)
1 0
Robby DunWhale
09/16/2017 9:57 PM
Tower of Fate (Specter)
2 0
Dad marinostyle
09/16/2017 7:54 PM
Armor Outpost (Plague)
0 0
Dad marinostyle
09/16/2017 7:43 PM
Troupple Pond (Plague)
2 0
Dad marinostyle
09/16/2017 7:38 PM
Armor Outpost (Plague)
why does the magic only work on him? I don't get it
0 0
Collin JCollin25
09/16/2017 6:53 PM
The Lich Yard
my dad hits me
0 0
Collin JCollin25
09/16/2017 6:52 PM
The Lich Yard
0 0
A-mari fruitseed8
09/16/2017 12:59 PM
Village (Plague)
Plague Knight isn't a bird! He is wearing an old witch doctor mask!
1 0
A-mari fruitseed8
09/16/2017 12:56 PM
Village (Plague)
Propeller Dagger!
0 0
Daddy d.don3668
09/16/2017 11:09 AM
Plains (Specter)
ahhhhhhhhhhhhhh!!!!
1 0
Yoshi Fan yoshi_fan_ftw
09/16/2017 8:35 AM
The Lich Yard
i did it. I DID IT
0 0
Elijah coolioe12
09/16/2017 8:34 AM
Tower of Fate (Specter)
chronos coin also helps
3 0
Yoshi Fan yoshi_fan_ftw
09/16/2017 8:33 AM
The Lich Yard
HE HAD HALF A HEART LEFT THEN I DIED
1 0
Elijah coolioe12
09/16/2017 8:33 AM
Tower of Fate (Specter)
i did it!!!!!
3 0
Yoshi Fan yoshi_fan_ftw
09/16/2017 8:28 AM
The Lich Yard
send me an ichor trough miiverse. PLEASE
0 0
Le'weesel zahnfamily
09/16/2017 7:09 AM
Armor Outpost
2 0
Noah Big_Scott
09/16/2017 6:21 AM
Plains
Why is there sans in my game
1 0
Lilya Meow TheMoriartyFam
09/16/2017 5:33 AM
Plains (Specter)
what's the cheat code?! tell me!!!!!!
2 0
Lilya Meow TheMoriartyFam
09/16/2017 5:30 AM
Plains (Specter)
me and my dad cant make him die,i was like so close, it was a tiny dot, in like the dark?thats hard
1 0
Elijah coolioe12
09/15/2017 7:05 PM
Iron Whale (Specter)
im reize and ill kill specter
1 0
Elijah coolioe12
09/15/2017 6:55 PM
Iron Whale (Specter)
i got cold sholder
0 0
Elijah coolioe12
09/15/2017 6:52 PM
Iron Whale (Specter)
praise yacht club for this game and its music
0 0
Elijah coolioe12
09/15/2017 6:29 PM
Lost City (Specter)
im dead and dangerous
0 0
Elijah coolioe12
09/15/2017 5:19 PM
The Lich Yard (Specter)
i did it
1 0
Brett brett77777
09/14/2017 8:06 PM
Village
This is so much fun! I'm so glad I got this game!!!
3 0
pai Guidoel
09/14/2017 9:09 AM
Village
lembra megaman
0 0
pai Guidoel
09/14/2017 3:02 AM
Plains
tudo bem?
0 0
pai Guidoel
09/14/2017 2:49 AM
Plains
0 0
Elijah coolioe12
09/13/2017 12:49 PM
Plains
rip miiverse
0 0
Elijah coolioe12
09/13/2017 12:48 PM
Plains
got all upgrades
6 1
Luigi GigaLuigiMoran
09/13/2017 10:37 AM
Cog Bounce Chaos
This challenge is infuriating!
1 0
Luigi GigaLuigiMoran
09/13/2017 9:31 AM
Iron Whale (Specter)
There's a pink diamond hidden in the upper left corner of this room.
1 0
Luigi GigaLuigiMoran
09/13/2017 9:16 AM
Iron Whale (Specter)
Cute manta!
0 0
$$$$$$$$$$ isaac2beast
09/13/2017 5:19 AM
Plains (Plague)
i hate himm!
1 0
Lil Isaac Dragondrush
09/12/2017 10:24 PM
Plains (Plague)
3 0
Phantom phantom_mw
09/12/2017 4:52 PM
Pridemoor Keep (Specter)
death
2 0
papa papajhd
09/12/2017 3:36 PM
Donjon de Fière-Lande
a fière land c'est nulle
0 0
Luigi GigaLuigiMoran
09/12/2017 8:44 AM
Tower of Fate (Specter)
LOLed at the kiss of death
1 0
Luigi GigaLuigiMoran
09/12/2017 7:36 AM
The Lich Yard (Specter)
cool secret!
1 0
Ryan :3 Ryan_Matteo
09/11/2017 4:51 PM
Plains
1 0
Phantom phantom_mw
09/11/2017 4:34 PM
Clockwork Tower (Specter)
you will fall befor my sithe
0 0
Pierre JumpHere
09/11/2017 10:24 AM
Clockwork Tower (Plague)
I sure am gonna miss Miiverse...
1 0
Gopher A_G00D_Sandwich
09/10/2017 5:04 PM
Pridemoor Keep
rip miiverse
3 0
★и¢κ¤★ THeDaRKPLaYeR404
09/10/2017 4:15 PM
Torre del Hado: ???? (Specter)
esto es imposible!!!!!!!!!
2 0
mini mii boowayne
09/10/2017 3:55 PM
Plains
1 0
deoblo aidanelliot
09/10/2017 3:30 PM
Plains (Specter)
black knight dead
0 0
deoblo aidanelliot
09/10/2017 3:21 PM
Plains (Specter)
specter knight is good for combat (much better than shovel knight)
2 0
mb AM2-GPK
09/10/2017 1:52 PM
Village
hi
0 0
****** Digipengiun2
09/10/2017 12:37 PM
Lost City
Make murica gud again
0 0
★и¢κ¤★ THeDaRKPLaYeR404
09/10/2017 12:30 PM
La Ciudad Perdida (Specter)
:v
0 0
*** dmsquarepants
09/10/2017 5:28 AM
Village
0 0
fishy starwarsiscool14
09/10/2017 5:03 AM
Pridemoor Keep
JUST GOT THE amiibo!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
1 0
tay cylus2310
09/10/2017 5:01 AM
Pridemoor Keep (Plague)
If Life is good?
2 0
tay cylus2310
09/10/2017 4:59 AM
Pridemoor Keep (Plague)
IfLife
1 0
Rex DrWari0
09/09/2017 10:04 PM
Plains
1 0
Apple PalutenaDesu
09/09/2017 8:26 PM
Clockwork Tower (Specter)
I LOVE THESE REMIXED SONGS
0 0
Eddie Eddie64
09/09/2017 8:18 PM
Village
9 0
Evenkhan Evenkhan
09/09/2017 5:04 PM
Campiña (Specter)
ja
1 0
Dad marinostyle
09/09/2017 3:56 PM
Tower of Fate (Specter)
playing as specter and plaugh knight is so satisfying
8 0
Settemio Settemio
09/09/2017 2:55 PM
Village
5 0
Santiago SantiChip2008
09/09/2017 1:53 PM
Flying Machine (Specter)
I'm Trying To Get Through Propeller Knight's Flying Something...It's Excruciatingly Hard...
0 0
Santiago SantiChip2008
09/09/2017 1:32 PM
Village
2 0
silo pikminman
09/09/2017 10:32 AM
The Lich Yard
im coming for ya specter knight
0 0
Gavin Griff_Trooper
09/09/2017 9:24 AM
Tower of Fate (Specter)
so cool!!!!!!!!!!!!!
2 0
Naji naji79
09/09/2017 6:21 AM
Plains
1 0
jt RedsoxRule
09/08/2017 8:00 PM
Stranded Ship
new game plus is hard
1 0
♪♪♪♪♪♪♪oz… spacechick365
09/08/2017 7:33 PM
The Lich Yard
0 0
Brandon stumpbeefgnaw
09/08/2017 4:07 PM
Stranded Ship (Specter)
0 0
Phantom phantom_mw
09/08/2017 4:00 PM
Pridemoor Keep (Specter)
1 0
cody kodiak644
09/08/2017 2:41 PM
Plains (Specter)
boop rip meme verse
0 0
FIN cutiger1972
09/08/2017 2:24 PM
Plains (Plague)
1 0
PikaPeyton lvpikachu
09/08/2017 12:12 PM
Pridemoor Keep
1 0
jude judeCB
09/08/2017 12:10 PM
Iron Whale (Specter)
YEAH! THIS DONOVAN ARMOR IS AWESOME!
1 0
jude judeCB
09/08/2017 11:02 AM
Tower of Fate: Entrance (Specter)
OHHOHO YEAAAH! I GOT ALL THE RED SKULLS!
0 0
jude judeCB
09/08/2017 9:29 AM
Iron Whale (Specter)
I CAN'T KILL THIS THING! WAIT...(SWITCH TO DREAD TALON). FACE FULL OF HYPE.
0 0
jude judeCB
09/08/2017 9:26 AM
Iron Whale (Specter)
Greastest music ever? ya lets go with that.
0 0
jude judeCB
09/08/2017 9:11 AM
Tower of Fate (Specter)
HAHAHAHAHAHA! YES DANCER, GET OUT!
0 0
jude judeCB
09/08/2017 9:09 AM
Tower of Fate (Specter)
GET OUT! YOU OVERGROWN BUTTHOLE!
2 0
jude judeCB
09/08/2017 9:05 AM
The Lich Yard (Specter)
HAHAHA! NEVER MESS WITH SPECTER KNIGHT!
0 0
jude judeCB
09/08/2017 9:01 AM
The Lich Yard (Specter)
GET THAT CRUD OUT OF MY HOUSE! BEAT IT PHANTOM STRIKER!
0 0
elliot mellow9
09/07/2017 5:19 PM
The Lich Yard
ok
2 0
bye izzyjones2007
09/07/2017 5:17 PM
Pridemoor Keep
this is very difficult!
1 0
PyroPuff FireTempest283
09/07/2017 4:18 PM
Village (Plague)
How do you get Mona to come back to her desk after you have done the main story in plague of shadow?
2 0
Jeffrey mikeyg7709
09/07/2017 1:42 PM
Flying Machine
Fell through the hole when he lost.
1 0
spencer Welder119
09/07/2017 1:38 PM
Village
worriers wanted friend welder119 to be hired reward 10000000000 gold
1 0
spencer Welder119
09/07/2017 12:41 PM
Pridemoor Keep
help me friend welder119 thats me
1 0
Luigi GigaLuigiMoran
09/07/2017 11:30 AM
Tower of Fate: Entrance (Plague)
Reminder that one of the music sheets is in this room.
0 0
Luigi GigaLuigiMoran
09/07/2017 11:02 AM
Tower of Fate: Entrance (Plague)
This room is very suspicious...
0 0
Luigi GigaLuigiMoran
09/07/2017 10:43 AM
Troupple Pond (Plague)
Pro tip: hold DOWN while wearing the golden tunic to engage in a most graceful dance.
1 0
Chepe chepepokmnmaster
09/07/2017 8:14 AM
Tower of Fate (Specter)
i find it odd that i'm realy bad at platformers yet i do good in shovel knight
2 0
Mykaela mykaela199
09/06/2017 5:42 PM
Tower of Fate: ????
I got the entrantress down to one hit left, theh died. yaaaaay, suftering ;-;
0 0
Mykaela mykaela199
09/06/2017 4:19 PM
Tower of Fate: Entrance
1 0
Mykaela mykaela199
09/06/2017 3:50 PM
Frigid Flight
2 0
adam jr. epiccraft
09/06/2017 3:12 PM
Flying Machine (Specter)
love this game! sad miiverse is getting taken down soon
1 0
Noah NoahthepikachuX3
09/06/2017 2:05 PM
Iron Whale
R.i.p miiverse
1 0
Jacob FlamingCookie
09/05/2017 7:41 PM
Flying Machine (Specter)
i fucken at this
1 0
Jacob FlamingCookie
09/05/2017 7:19 PM
Flying Machine (Specter)
this is soooo hard !
0 0
Isaiah ikanator
09/05/2017 12:52 PM
Troupple Pond
2 0
Noah EpicNoah
09/05/2017 12:45 PM
Plains (Plague)
TwT
0 0
tay cylus2310
09/05/2017 12:18 PM
Troupple Pond
namehave
0 0
datbeaties datbeatiesman
09/05/2017 8:10 AM
Flying Machine (Specter)
edgy maaaan
0 0
datbeaties datbeatiesman
09/05/2017 6:36 AM
Tower of Fate (Specter)
A good challenge
3 0
Andrés AE_1085
09/05/2017 6:19 AM
Tower of Fate: ???? (Specter)
Low % makes this fight near impossible
1 0
Squidward Justinbaws777
09/05/2017 5:02 AM
Plains (Specter)
Its been so long. Though clunky, i love the Spectre mode!
2 1
Jack The_Sapps
09/04/2017 10:03 PM
Dirt Clod Dash
Go right at the beginning
1 0
Rafa Aparafioras
09/04/2017 5:20 PM
Villa
el 1 nivel me costo mucho
1 0
jude judeCB
09/04/2017 4:57 PM
Clockwork Tower (Specter)
TINKER KNIGHT! YOU GOT SOME NERVE TO SET UP A STAGE LIKE THIS! YOU OWE ME ALOT OF MONEY!
2 0
jude judeCB
09/04/2017 2:54 PM
Stranded Ship (Specter)
CAN SOMEONE PLEASE TELL ME WHAT IS POLAR KNIGHT'S WEAKNESS?
1 0
jude judeCB
09/04/2017 2:32 PM
Tower of Fate (Specter)
LET'S GO REIZE! HAVE AT YOU!
4 0
jude judeCB
09/04/2017 2:28 PM
Tower of Fate (Specter)
NO THIS IS AN EPIC BOSS FIGHT! COULD REIZE KEEP HIS POWER LIKE BLACK KNIGHT?
3 0
jude judeCB
09/04/2017 2:22 PM
Explodatorium (Specter)
despite your story mode plague knight, your boss fight STILL SUCKS!
2 0
pipe pipexero
09/04/2017 1:33 PM
Campiña
Comenzando este nuevo juego !!
1 0
naynay wilson-gamers-3
09/04/2017 12:39 PM
Plains
1 0
gavin Gavo2009
09/04/2017 10:28 AM
The Lich Yard
these ghost are anoying
4 0
CrayA LordLeinad
09/04/2017 10:17 AM
Plains
3 0
CrayA LordLeinad
09/04/2017 10:02 AM
Plains
1 0
CrayA LordLeinad
09/04/2017 10:01 AM
Plains
iv olnost bet da game!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
3 0
CrayA LordLeinad
09/04/2017 9:57 AM
Plains
3 0
BDazzler ssbdazzler
09/04/2017 8:56 AM
Village
sup
1 0
derp mathershifter
09/04/2017 8:48 AM
Plains
2 0
Raist Raister
09/04/2017 7:55 AM
Plains
2 0
Joma staple72
09/03/2017 8:06 PM
Pridemoor Keep
1 0
Joma staple72
09/03/2017 7:47 PM
Plains
Playing this game for the nth time!
1 0
Lexie B. TemariTrainer
09/03/2017 6:20 PM
Plains
1 0
sans sonilk
09/03/2017 5:18 PM
Flying Machine
0 0
Virus BespokeSpider91
09/03/2017 4:11 PM
The Lich Yard
beat spectere and king
0 0
rick richardpe
09/03/2017 2:24 PM
Armor Outpost
1 0
Blobfish Kdoubleh
09/03/2017 2:10 PM
Armor Outpost
whats with ???? lol
1 0
Gavin GWATS8
09/03/2017 1:58 PM
Plains (Specter)
Just got the update!!! this is ssssooooo cool
1 0
Blobfish Kdoubleh
09/03/2017 1:14 PM
Explodatorium (Plague)
Where is Plague's room?
0 0
Francisco Francisco35
09/03/2017 12:29 PM
Tower of Fate: Ascent (Plague)
I collected all cipher coins in one go!
0 0
ETHAN billyjack710
09/03/2017 11:26 AM
The Lich Yard
1 0
Peighton SharkbaitOoBaDoo
09/03/2017 10:51 AM
The Lich Yard
1 0
The Gamer rjgutierrez95
09/03/2017 10:49 AM
Flying Machine
last knight on challenge mode!
0 0
doc redhairedluigi
09/03/2017 7:23 AM
The Lich Yard
0 0
linkchidri linkchidori1
09/02/2017 10:52 PM
The Lich Yard
When is your first Shovel Knight post, but you hear that Miiverse is closing
1 0
Tom FullmetalRaiden5
09/02/2017 8:19 PM
Pridemoor Keep (Specter)
For a darker story, the music in this level is much happier than in Shovel of Hope.
1 0
Mara Koomer11
09/02/2017 6:58 PM
Pridemoor Keep (Plague)
2 0
★Maxi★ FlashFox24
09/02/2017 5:52 PM
Hall of Champions
3 0
mario JohnJohnElliott
09/02/2017 5:12 PM
Plains (Specter)
rip miiverse :(
3 0
kevin braydenrocks1029
09/02/2017 4:43 PM
Village
me too!!!
3 0
dad JohnsonBois
09/02/2017 3:08 PM
Plains (Specter)
Its so awesome how I get to play as different knights,but I really hate Plauge Knight
0 0
Ace tbenton5130
09/02/2017 1:36 PM
Tower of Fate: Ascent
Rip shovel of hope new game+ tower of fate acent R.I.P
0 0
king lex pedal1
09/02/2017 12:17 PM
Tower of Fate (Specter)
i beat the game with an amibo
0 0
SrPiggyx3 CoolPig03
09/02/2017 11:55 AM
Finca de Liches (Specter)
Que bonito cuarto tiene Specter Knight Xd
0 0
Blobfish Kdoubleh
09/02/2017 11:31 AM
Pridemoor Keep (Plague)
0 0
Max t.v. stevesshelly
09/02/2017 10:15 AM
The Lich Yard
Nice try Specter
0 0
Zac zacswiiu
09/02/2017 10:09 AM
Troupple Pond
1 0
Gavin Griff_Trooper
09/02/2017 10:07 AM
Pridemoor Keep (Specter)
7 Down 4 to go
0 0
Zac zacswiiu
09/02/2017 9:52 AM
Plains
dig that fire ;D
1 0
Caleb The_Bossitron
09/02/2017 9:26 AM
Village
3 0
Spooky Jake_Arkenson
09/02/2017 8:48 AM
Pridemoor Keep
poopfarts
5 0
Tavares Tavares2105
09/02/2017 8:44 AM
Explodatorium
helloooo
2 0
Eliza ElizaRae
09/02/2017 6:36 AM
Plains
0 0
Bones MeltedMetal
09/02/2017 12:30 AM
Stranded Ship (Specter)
I'm so bad at this game... Still love it though!!!!!
0 0
Eliza ElizaRae
09/01/2017 6:36 PM
Plains
1 0
William willnuns
09/01/2017 6:32 PM
Village (Plague)
Grandma Swamp
2 0
EL Hambone tacolord27
09/01/2017 4:33 PM
Tower of Fate: Entrance
Dank a dank a dank a dee dank dank dank dank a dee dank dee dank dank daaaannnnnkkkk
0 0
Bernardo47 BernardoXD5
09/01/2017 4:04 PM
Explotatorium (Plague)
1 0
Blobfish Kdoubleh
09/01/2017 3:08 PM
Village
lol hoop kid's reaction tho
2 0
AlexParker bmcall3168
09/01/2017 1:03 PM
Tower of Fate: Entrance (Plague)
dude chill
0 0
Gavin Griff_Trooper
09/01/2017 12:50 PM
Lost City (Specter)
mole is so hard!!!!!!!!!!!!!!!!!!!
0 0
Gavin Griff_Trooper
09/01/2017 11:46 AM
Plains (Specter)
my god this is amazing!!!!!!
0 0
omar omarcito16
08/31/2017 4:21 PM
Campiña (Specter)
omar
0 0
Mom newspirit2015
08/31/2017 3:49 PM
The Lich Yard (Plague)
1 0
Noah noahsmash71104
08/31/2017 2:47 PM
Encounter - Plains
log #1 The days have been long and i have a huge raging bone
0 0
oden coolra66
08/31/2017 1:35 PM
Iron Whale
so hard
0 0
Paddy Wookieefeet
08/31/2017 1:03 PM
Flying Machine
Propeller Knight? More like Loser Knight!
0 0
Shrimp JonesTeeth
08/31/2017 12:28 PM
Tower of Fate (Specter)
5 0
Kody MAJORtom134
08/30/2017 7:23 PM
Lost City
oof
0 0
>(ð_ð)> AviatedControl
08/30/2017 7:19 PM
Plains
bubble level 1 got me stuck
1 0
Elias ChowderHound2010
08/30/2017 6:01 PM
Clockwork Tower (Specter)
i WILL WIN
0 0
isaac IsaacA2005
08/30/2017 2:59 PM
Flying Machine
spam bait bombs
0 0
isaac IsaacA2005
08/30/2017 2:55 PM
Flying Machine
is he even possible to beat ps i no he can but it is basicle inpossible
0 0
Panda King pandaking5575
08/30/2017 12:54 PM
Clockwork Tower
shovel knight im loven it
1 0
jag BOOMDAPOW1000
08/30/2017 9:31 AM
The Lich Yard
infinadagger inifaoutburger
0 0
Ryan BS_Alliance
08/30/2017 6:18 AM
Tower of Fate (Specter)
i beat new game plus
1 0
sam darkwarrior1019
08/30/2017 5:10 AM
Plains
i finished the shovel knight and plague knight level, ON TO THE SPECTER KNIGHT ONE!!!!
2 0
Jaden GrainedCargo192
08/29/2017 8:20 PM
Armor Outpost
Miiverse is ending.
2 0
isaac IsaacA2005
08/29/2017 8:18 PM
Tower of Fate (Specter)
if you git the kiss of death enough it will kill you
4 0
isaac IsaacA2005
08/29/2017 5:08 PM
Hall of Champions
i found arin to and was watching game grumps
0 0
Code mundizle
08/29/2017 3:56 PM
Plains
I HAVE THIS GAME ON EVERY NINTENDO CONSOLE !!!!!!!
2 0
DOGE CAT_EYE27
08/29/2017 3:32 PM
Stranded Ship (Plague)
y this game hard
0 0
Sarah Tiszus
08/29/2017 2:28 PM
Tower of Fate: ????
0 0
Elijah ajeicfive2004
08/29/2017 1:57 PM
Forest of Phasing
This guy is amazing!!!!
2 0
Elijah ajeicfive2004
08/29/2017 1:48 PM
Forest of Phasing
This guy sucks!!!
1 0
redek redeksin
08/28/2017 9:06 PM
Campiña
izzii pissii
2 0
Elias ChowderHound2010
08/28/2017 5:35 PM
The Lich Yard
ITS TO HARRRD WHY
2 0
Elias ChowderHound2010
08/28/2017 5:34 PM
The Lich Yard
its SO HAARRRRRRDD
0 0
Mitchell foxyfazbear800
08/28/2017 2:03 PM
Village
up againt the enanter next hope it goes well
0 0
Noah shinyghost
08/28/2017 12:50 PM
Tower of Fate (Specter)
2 0
Andrew Star_Wars_Fan021
08/27/2017 6:19 PM
The Lich Yard
Ur level is soooooooooooooooooo hard!!!!
2 0
Guy arqbust
08/27/2017 4:29 PM
Plains
how do i get past the bubble in level one?
1 0
The Gamer rjgutierrez95
08/27/2017 4:09 PM
Explodatorium
this game is so hard!
1 0
§§Manolo§§ martinvelasco123
08/27/2017 1:55 PM
Torre del Hado: Entrada
53 attemps f*c*
0 0
The Gamer rjgutierrez95
08/27/2017 1:18 PM
The Lich Yard
FIRST TRY BABY!!
1 0
The Gamer rjgutierrez95
08/27/2017 12:59 PM
Village
look at the strong knight i made!
1 0
Deano DeanDog31
08/27/2017 8:37 AM
Stranded Ship
ahhhhh
0 0
D miahashim
08/27/2017 8:23 AM
Village (Plague)
I do
0 0
Matt Snotgum
08/26/2017 6:57 PM
The Lich Yard
gy
0 0
Cheebs crummy-juncture
08/26/2017 6:39 PM
Explodatorium (Specter)
0 0
Mr.J Mr.Squeakums7331
08/26/2017 3:04 PM
Flying Machine (Specter)
And i thought Plauge Knight was hard......... no spoioere sorry i lied... ö
0 0
Gabe ferguson321
08/26/2017 2:22 PM
Clockwork Tower
this is the last knight left for me to fight
0 0
mrio dadsclone
08/26/2017 7:39 AM
Plains (Specter)
1 0
sans marioandqrock
08/26/2017 7:09 AM
Plains
Is dark knight actually spongebob squarepants? yes listen to their laughs!
0 0
sans marioandqrock
08/26/2017 7:05 AM
Plains
1 0
seth sethtgm
08/25/2017 8:16 PM
Plains (Specter)
wow new game plus
0 0
seth sethtgm
08/25/2017 7:36 PM
Tower of Fate: ???? (Specter)
not with the power of cheat codes
2 0
Wench FaireWench
08/25/2017 6:07 PM
Plains (Specter)
New Game + is so rad! :)
2 1
b braden18
08/25/2017 5:22 PM
Plains (Specter)
1 0
The Gamer rjgutierrez95
08/25/2017 3:55 PM
Village (Plague)
I am doctor knight!!
2 0
VictorAlvz VictorAlvz
08/25/2017 12:23 PM
Stranded Ship
Soy Malo
0 0
VictorAlvz VictorAlvz
08/25/2017 12:07 PM
Flying Machine
No Fue Muy Sensillo Pero Estubo Mas Fasil Que Todo El Nivel
0 0
Rosspeck Kiddymon
08/25/2017 12:04 PM
The Lich Yard
1 0
VictorAlvz VictorAlvz
08/25/2017 12:03 PM
Flying Machine
Aqui Perdiendo Mucho Dinero
0 0
VictorAlvz VictorAlvz
08/25/2017 11:23 AM
Clockwork Tower
Que Onda Con Este Gfe??
0 0
VictorAlvz VictorAlvz
08/25/2017 11:04 AM
Frigid Flight
Se Que No Puedo Bolar ;v
0 0
MicroMega simplechic
08/25/2017 10:09 AM
The Lich Yard
3 0
Kiki kikimoemoe123456
08/25/2017 9:17 AM
Plains
hes got a point
1 0
EL Hambone tacolord27
08/24/2017 5:17 PM
Flying Machine
I HAVE 20 CHECKPOINTS
0 0
jonas jsant807
08/24/2017 3:11 PM
Clockwork Tower (Specter)
gyj
0 0
William littlewill7
08/24/2017 10:19 AM
Plains (Specter)
0 0
A.M. MozartSenpai
08/23/2017 6:52 PM
Encounter - Reize
Yay! I finally defeated Reize!
4 0
girl wario FlaxSeedz
08/23/2017 3:40 PM
Plains (Plague)
im hip
1 0
morley Tictacs5108
08/23/2017 11:02 AM
Plains (Plague)
try bomb blast then fly
1 0
Big Daddy PuzzleFactory
08/23/2017 10:12 AM
Troupple Pond
1 0
kyle bchinzi87
08/23/2017 10:04 AM
Explodatorium
i cant erither
0 0
oden coolra66
08/22/2017 10:19 PM
Pridemoor Keep
i was stuck on black knight now king knight
0 0
morley Tictacs5108
08/22/2017 5:02 PM
Pridemoor Keep
pogo on book then go
2 0
A.M. MozartSenpai
08/22/2017 4:11 PM
The Lich Yard
I need help on killling Specter Knight. Any tips?
4 2
Flea dcweas
08/22/2017 9:27 AM
Troupple Pond
Attack of the bone clang gang!
4 0
sammy ajarash5
08/21/2017 8:28 PM
Pridemoor Keep
WHAT DO I DO?!?!?!!??!???! >.<
0 0
sammy ajarash5
08/21/2017 6:18 PM
Plains
someone make ur name "X&BUTT"
2 0
liam psykobowler
08/21/2017 3:03 PM
Plains
tails the fox more like tails the box
6 0
liam psykobowler
08/21/2017 2:55 PM
Plains
XD
0 0
Theopold!? tyoier
08/21/2017 12:57 PM
Tower of Fate (Specter)
Now, I'll go play Mario Maker
0 0
Theopold!? tyoier
08/21/2017 12:56 PM
Tower of Fate (Specter)
Avatar: To be or not to be...
2 0
Theopold!? tyoier
08/21/2017 12:54 PM
Tower of Fate (Specter)
It's literally a secret to everybody!
0 0
ch.toad chiquitin2009
08/21/2017 10:15 AM
Encuentro - Reize
2 0
ch.toad chiquitin2009
08/21/2017 10:11 AM
Encuentro - Reize
¿pro? ¿protoman?
2 0
EL Hambone tacolord27
08/21/2017 9:14 AM
Pridemoor Keep
Man king knights level is hard
1 0
brayden anreskillam
08/21/2017 9:00 AM
Plains (Specter)
hi!!!
4 0
ch.toad chiquitin2009
08/21/2017 8:34 AM
Explotatorium
este juego es recomendable
4 0
ivan lcavazos80
08/21/2017 4:54 AM
Explodatorium
good job you won nintendo cuz nintendo did exploding tertles in only one game and now exploding rats
1 0
ivan lcavazos80
08/21/2017 4:45 AM
Iron Whale
i could use the shell fo houers
0 0
ivan lcavazos80
08/20/2017 7:04 PM
Explodatorium
this levle is imcane
2 0
ivan lcavazos80
08/20/2017 6:51 PM
Explodatorium
This is so hard
0 0
Rafael RS fafallito2008
08/20/2017 3:43 PM
Fortaleza del Orgullo
la muerte infernal
1 0
Pane Crorry
08/20/2017 1:23 PM
Pridemoor Keep
Ke onda
1 0
Trey treygibb
08/20/2017 12:57 PM
Tower of Fate: Entrance (Plague)
i hate this part!!!
1 0
jayson jaytan27
08/20/2017 10:14 AM
The Lich Yard
Im doing a cheat code where all enemies can 1-hit-KO you... help me...
5 0
Justblaze justindellacorte
08/20/2017 8:41 AM
Explodatorium
i cannot beat this guy omg
1 0
speedy b SpeedyBl
08/20/2017 8:30 AM
Clockwork Tower (Specter)
so hard! the clockwork man!
1 0
Hero ST stuartberger
08/20/2017 8:22 AM
Pridemoor Keep
Timr to Dig some graves!
4 0
André wcalegari
08/20/2017 7:16 AM
Flying Machine
sauve
1 0
samuel.c wiiuscbclcec
08/20/2017 4:35 AM
Flying Machine
gfdsethj
1 0
Mighty SpartanCookie
08/20/2017 4:09 AM
Lost City
i guess you could say, mole knight got GROUNDED
4 0
rick richardpe
08/20/2017 1:45 AM
The Lich Yard
burn
3 0
Terrybear ostranenie1913
08/19/2017 9:17 PM
Troupple Pond
begone thot
8 0
Terrybear ostranenie1913
08/19/2017 8:08 PM
Plains
PRAISE KEK
2 0
ArtisYeti artisticyeti
08/19/2017 7:21 PM
Forest of Phasing
When you succeed only to find out what happens if you shovel jump on a save point... :(
1 0
Mateo x3XTR0113RMGx
08/19/2017 5:03 PM
Campiña
typically
2 0
Justblaze justindellacorte
08/19/2017 4:36 PM
Plains
killt his azz
4 0
Boss Man Caravan25
08/19/2017 1:50 PM
Tower of Fate: Entrance (Specter)
with Judgement Slash..like a boss.
2 0
Boss Man Caravan25
08/19/2017 1:44 PM
Tower of Fate: Entrance (Specter)
that part is soooo awsome!
1 0
Mlgfrags!! reddom
08/19/2017 1:43 PM
Plains
hi
1 0
Boss Man Caravan25
08/19/2017 1:17 PM
Tower of Fate (Specter)
YEES!
10 0
Boss Man Caravan25
08/19/2017 1:11 PM
Tower of Fate (Specter)
not a fan of dance
3 0
Boss Man Caravan25
08/19/2017 1:10 PM
Tower of Fate (Specter)
do i detect a hint of sarcasm in your voice
1 0
Boss Man Caravan25
08/19/2017 1:04 PM
The Lich Yard (Specter)
by far my favorite boss of this expantion
1 0
Boss Man Caravan25
08/19/2017 1:01 PM
The Lich Yard (Specter)
BEST ENTERINCE EVER!
1 0
Boss Man Caravan25
08/19/2017 12:46 PM
The Lich Yard (Specter)
home sweet home
1 0
Boss Man Caravan25
08/19/2017 12:23 PM
Tower of Fate (Specter)
dragon knight...Kamen Rider!
1 0
Reston?! FierceDietyRESTO
08/19/2017 8:49 AM
The Lich Yard
nooooooooooo
1 0
adam 1Groovyfamilywii
08/19/2017 8:25 AM
Tower of Fate (Specter)
where do you get the clocks
8 0
Mr.Hyde djmrhyde
08/19/2017 6:20 AM
Plains
jfhgjhhcbjvjgmfo
2 0
SSBrothers SSBrothers062600
08/18/2017 8:58 PM
La Ciudad Perdida
0 0
2D danigamer34
08/18/2017 7:04 PM
Torre del Hado: Entrada
4 0
cade battlekid360
08/18/2017 5:30 PM
Plains (Specter)
i love this game
3 0
alice wolo08
08/18/2017 4:59 PM
Tower of Fate (Specter)
6 0
JR junior361
08/18/2017 4:10 PM
Lost City
Yo sil, be my friend mang
1 0
JR junior361
08/18/2017 3:37 PM
Iron Whale
...
0 0
SSBrothers SSBrothers062600
08/18/2017 1:30 PM
Explotatorium
mas facil que specter knight
0 0
Justin ShinyM12345
08/18/2017 1:00 PM
Plains
2 0
hottoo08 hottoo08
08/18/2017 11:55 AM
Plains
hola
1 0
Eve TrishaElric
08/18/2017 11:49 AM
The Lich Yard
1 0
CONNOR keepsnapping
08/18/2017 10:29 AM
The Lich Yard
fighting the specter knight
2 0
Zombie Colematheson
08/17/2017 11:25 AM
Troupple Pond
Cherio
3 0
jacob.j destructo2k3
08/17/2017 9:41 AM
Pridemoor Keep
vgfy
0 0
Lonk KimBurt29
08/17/2017 9:11 AM
Plains (Plague)
im using god mode
1 0
adam 1Groovyfamilywii
08/16/2017 7:21 PM
Stranded Ship (Plague)
the frosted place is hard
0 0
Kyle ezs1622
08/16/2017 5:54 PM
Clockwork Tower
Tinker knights level is easy, but the BOSS!!!
0 0
tootybooty Dogeanddonger
08/16/2017 3:22 PM
Tower of Fate (Specter)
2 0
jonathan teamsowers
08/16/2017 12:16 PM
The Lich Yard
yeah please your cool
1 0
linkgamer jaynoahh
08/16/2017 10:58 AM
The Lich Yard (Specter)
1 0
linkgamer jaynoahh
08/16/2017 10:52 AM
The Lich Yard (Specter)
how do rind a room
1 0
SSBrothers SSBrothers062600
08/16/2017 10:48 AM
Fortaleza del Orgullo
los libros es lo difícil
0 0
argonos argenisyael
08/16/2017 9:23 AM
Torre del Hado: Ascensión
por que !!!! >:v
0 0
Christ!an Kaepora-Gaebora6
08/15/2017 7:49 PM
Plains
Nice boss battle!
5 0
Coolguy Barks808
08/15/2017 1:07 PM
Tower of Fate: Entrance (Specter)
so hard
0 0
Noah shinyghost
08/15/2017 11:35 AM
Stranded Ship (Specter)
0 0
SSBrothers SSBrothers062600
08/14/2017 10:10 PM
Fortaleza del Orgullo
I hate this
0 0
Coolguy Barks808
08/14/2017 6:53 PM
Tower of Fate: Entrance (Specter)
what the heck
1 0
Coolguy Barks808
08/14/2017 6:25 PM
Flying Machine (Specter)
woah
0 0
Grant MelonSmasher999
08/14/2017 4:56 PM
Plains (Specter)
4 0
Emiledude Dudemile
08/14/2017 3:49 PM
Jardin des Liches
JAI RÉUSSIR A TUER LE 3 BOSS DU JEU ATTENCION LES GARS QUI LE COMBATE! VOUS ALLER MORVFLER
2 0
Bry Deims Snarflord
08/14/2017 3:27 PM
Stranded Ship (Specter)
so be it longshanks!
0 0
zackattack thrashkid
08/14/2017 2:29 PM
Tower of Fate: Ascent
in specter knight there is 1 checkpoint
2 1
zackattack thrashkid
08/14/2017 2:24 PM
Clockwork Tower
1 0
daddy Bonhammer
08/14/2017 11:39 AM
Plains (Plague)
im stuck on the part where there is a skinny platform with an enemy on it
2 0
Max max2695
08/14/2017 10:01 AM
Tower of Fate (Specter)
I really like specter knight and his back story
4 0
Joe Bros! jmlabelle65
08/14/2017 9:45 AM
Pridemoor Keep
good gay 10/10
0 0
BraydenTcr branda.m26
08/13/2017 9:54 PM
Tower of Fate: Entrance (Specter)
Ouch.
0 0
Andy LUBUofDW
08/13/2017 8:17 PM
Pridemoor Keep (Specter)
check near the Checkpoints
0 0
Terranovaa Midobo
08/13/2017 7:55 PM
Flying Machine (Specter)
Well this is hard
2 0
crazymonk kahlil1617
08/13/2017 7:37 PM
Pridemoor Keep
omg..... i one @!!!!!!!!!!!!!! ho mama get that out of here!
3 1
crazymonk kahlil1617
08/13/2017 7:34 PM
Pridemoor Keep
someone help me if you know comanted!
0 0
crazymonk kahlil1617
08/13/2017 7:24 PM
Pridemoor Keep
0 0
crazymonk kahlil1617
08/13/2017 7:22 PM
Pridemoor Keep
i did it i beat that book part! yay :-) )
1 0
crazymonk kahlil1617
08/13/2017 7:18 PM
Pridemoor Keep
easy guy's go up then keep on jumpping!!
1 0
crazymonk kahlil1617
08/13/2017 7:09 PM
Pridemoor Keep
0 0
davipimpe davimurisoca
08/13/2017 5:37 PM
Planícies
massaroca
1 0
Claudio cnavarroh
08/13/2017 3:51 PM
Villa
Primera vez jugando Shovel Knight!!! buen juego.
1 0
Modificar lcbrasiliense
08/13/2017 3:41 PM
Village
this game is good (:
0 0
Anakin joshjenke2002
08/13/2017 2:41 PM
Armor Outpost (Plague)
all hail the trouple king
0 0
luis Luis6438
08/13/2017 2:07 PM
Explotatorium
0 0
adrian c1ashcityrocker
08/13/2017 2:00 PM
Flying Machine (Specter)
ez
0 0
adrian c1ashcityrocker
08/13/2017 1:52 PM
Flying Machine (Specter)
Man, this level really BLOWS me away.
1 0
Mr.Glory64 getmoe
08/13/2017 12:59 PM
Flying Machine
1 0
Beckett snekfam
08/13/2017 12:38 PM
Plains
i beat black knight
2 0
William WillyD3
08/13/2017 12:31 PM
Tower of Fate (Specter)
i did it :D
2 0
William WillyD3
08/13/2017 12:09 PM
Tower of Fate (Specter)
hover plume helps
7 0
Pablo D. huasi420
08/13/2017 12:04 PM
The Lich Yard
0 0
Gigi Diophantic
08/13/2017 11:58 AM
Plains (Specter)
specter knight victory!
0 0
Pablo D. huasi420
08/13/2017 11:55 AM
The Lich Yard
0 0
Pablo D. huasi420
08/13/2017 11:34 AM
Pridemoor Keep
0 0
Pablo D. huasi420
08/13/2017 11:08 AM
Pridemoor Keep
Quiero esa gema :'v
0 0
DROX 125 DROX126
08/13/2017 9:16 AM
Tower of Fate: Entrance
kek
3 0
Mike Looney_Mike
08/13/2017 6:47 AM
Clockwork Tower
one life ord left beat tinker knight
0 0
im short meshort
08/12/2017 9:10 PM
The Lich Yard
Specter Butt!
3 0
tj'sgreat tjsgreat
08/12/2017 8:56 PM
Tower of Fate (Specter)
yea this if u thought baz was a bear i did i dont know why
1 0
tj'sgreat tjsgreat
08/12/2017 8:35 PM
Stranded Ship (Specter)
to easy to be a boss a gold armor from tinker knights stage is harder
0 0
tj'sgreat tjsgreat
08/12/2017 7:05 PM
The Lich Yard (Specter)
if u have the giant skeleton fall in the pit his head will spin and explode
1 0
tj'sgreat tjsgreat
08/12/2017 6:42 PM
Pridemoor Keep (Specter)
love this little easter egg found it on accident
1 0
Anakin joshjenke2002
08/12/2017 4:48 PM
Explodatorium (Plague)
all hail the trouple king
1 0
Sam sampootis
08/12/2017 4:32 PM
Flying Machine
I LOST ALL MY GOLD THANKS PROPLER KNIGHT!!!!
1 0
Logan aaronnguyen
08/12/2017 2:58 PM
The Lich Yard
1 0
tj'sgreat tjsgreat
08/12/2017 2:55 PM
Flying Machine
if i die one more time on this im throwing my gamepad through the tv
1 0
tj'sgreat tjsgreat
08/12/2017 2:38 PM
Flying Machine
oh man ishouldnt have broken that checkpoint fighting that enemy
0 0
Beckett snekfam
08/12/2017 2:09 PM
Stranded Ship
treasure knight
3 1
corderion corderion12
08/12/2017 1:56 PM
Navire Échoué (Specter)
hjjkop
0 0
Ethan junior122289
08/12/2017 1:15 PM
Flying Machine (Specter)
0 0
Ô¢to Ceec theCees
08/12/2017 1:10 PM
Pridemoor Keep
4 0
Miguel G LaPatataOscura
08/12/2017 12:47 PM
Fortaleza del Orgullo
apenas y los mato a los jefes finales xd
0 0
leon grenincat
08/12/2017 12:25 PM
Plains
0 0
jush JUSH1000
08/12/2017 10:38 AM
Armor Outpost
1 0
Adam InfinityCross
08/12/2017 5:38 AM
Plains
amazing
1 0
Holden Pokefan3000
08/11/2017 9:11 PM
Dirt Clod Dash
Uggghhhh
2 0
Andy LUBUofDW
08/11/2017 7:40 PM
Hall of Champions
woo i beat king of the not boos
0 0
Tristan:) JayDubDub
08/11/2017 7:26 PM
The Lich Yard
2 0
tj'sgreat tjsgreat
08/11/2017 7:09 PM
Clockwork Tower
yea this post if u always wanted a life size mech that tinker knight uses
3 0
caleb calebvallejo
08/11/2017 6:14 PM
Plains
Lol just playing some shovel knight
0 0
gnrl woomy generalwoomy0_0
08/11/2017 4:28 PM
Tower of Fate (Specter)
my b button is not working wat teh heck
3 0
Braydon Trooper8
08/11/2017 4:22 PM
Stranded Ship (Specter)
Moo
0 0
maxi maximorojas
08/11/2017 4:14 PM
Fortaleza del Orgullo (Specter)
0 0
elizabeth elizabeth200928
08/11/2017 3:58 PM
The Lich Yard
3 0
Link★16 PuunyPuff
08/11/2017 3:19 PM
Plains (Plague)
1 0
Jessie Pokeperson678
08/11/2017 3:14 PM
Tower of Fate (Specter)
This games is so fun but so hard
3 0
William WillyD3
08/11/2017 1:59 PM
Stranded Ship
how to get rich. go to boss, get hp to 1, use alchmey coin on boss, 9999999999 gold!
1 0
Afton armydillo64
08/11/2017 11:51 AM
Plains
rail mail is amazingly awesome
1 0
vlade vlade521
08/11/2017 9:38 AM
Villa
bum!
0 0
Beck Beckmala
08/11/2017 8:10 AM
The Lich Yard (Specter)
i love the music but i hate the enemys so much that i cant get past the first checkpoint
1 0
Jaxxon jaxxon_mario
08/11/2017 7:34 AM
Plains
patatos suck
3 0
Baiionetta Nonon-Chaaan
08/10/2017 9:33 PM
Lost City
0 0
B-ray rustedmushroom
08/10/2017 7:57 PM
Clockwork Tower (Specter)
I smell a boss
0 0
tj'sgreat tjsgreat
08/10/2017 7:13 PM
Tower of Fate: ???? (Plague)
i beat shovel knight treasure trove and also yea this post if u only replay games for the last boss
2 0
omar lenguapr
08/10/2017 7:11 PM
Plains (Specter)
5 0
Quitepye7 Quitepye7
08/10/2017 6:27 PM
Tower of Fate (Specter)
Is it odd that I enjoy Specter Knight more than Shovel Knight?
9 0
Cotias Cotias389
08/10/2017 4:40 PM
Lagoa Truçã
Muito bom esse game, gosto do estilo!
1 0
Lemon Tetrisized00
08/10/2017 4:22 PM
Tower of Fate (Specter)
England is my city.
3 0
Jacob Mr.JacobMan
08/10/2017 4:15 PM
Pridemoor Keep (Plague)
0 0
Jamey Beezojuju
08/10/2017 3:39 PM
Plains (Plague)
i think i have a face?
2 0
Major MajorShriner
08/10/2017 2:36 PM
Tower of Fate (Specter)
ruby rose vs spectar knight
3 0
м♪•мзмз hotpocket1492
08/10/2017 11:00 AM
Unarmed Ascent
0 0
Dawson bigfoot562
08/10/2017 9:42 AM
Clockwork Tower
WHY
0 0
Edinilsu youtouber
08/10/2017 2:40 AM
O Jardim do Espectro
esse nivel e inferno e igual
1 0
Tenoshi JPLanh
08/10/2017 12:55 AM
Stranded Ship
you can easily get the arc of iron achievement here with the ladder guys
1 0
lando Frijolitolando
08/09/2017 5:43 PM
Tower of Fate (Specter)
siiiiiiiiiiii king knight
0 0
tj'sgreat tjsgreat
08/09/2017 3:00 PM
Tower of Fate: ???? (Plague)
woah what the heck is this thing ahhh help
0 0
TheGobbler BIRTHDAYSMURFDOG
08/09/2017 12:38 PM
Pridemoor Keep
#Justgotthrone #Kingknight
3 0
DyLaN Sprmw11
08/09/2017 11:16 AM
The Lich Yard (Specter)
is there any secret in this room?
0 0
dsm son Kibeanthor
08/09/2017 10:09 AM
The Lich Yard
dantdm
1 0
dsm son Kibeanthor
08/09/2017 10:07 AM
The Lich Yard
dantdm
1 1
Carpatio aborealis
08/08/2017 8:16 PM
Plains
THIS GAME IS AWESOME
3 0
Nathan sonickid18
08/08/2017 12:59 PM
Clockwork Tower
Clock Tower Is Soooooooo Hard
1 0
MAC zykario87
08/08/2017 12:55 PM
Plains
4 0
Nintenerd Narvaez123
08/08/2017 12:33 PM
Tower of Fate (Specter)
sup
1 0
Rosa Parks davesr33
08/08/2017 12:31 PM
Flying Machine
I think boss fights are less hard than the actual levels
1 0
Cole 5ccccs
08/08/2017 11:39 AM
Tower of Fate: ???? (Specter)
Welcome to Tony Hawk's Pro Skater 7.
5 0
hueso hueso_xd
08/08/2017 10:47 AM
Fortaleza del Orgullo
0 0
☆superstar PrincessBirdy
08/08/2017 10:24 AM
Plains
1 0
Stephen Konxol
08/08/2017 9:57 AM
Explodatorium (Specter)
to the order!... plague knight.
0 0
Stephen Konxol
08/08/2017 9:39 AM
Explodatorium (Specter)
2 0
Stephen Konxol
08/08/2017 9:37 AM
Tower of Fate (Specter)
2 0
Stephen Konxol
08/08/2017 8:30 AM
Plains (Specter)
spectre knight!!
0 0
Stephen Konxol
08/08/2017 12:20 AM
Pridemoor Keep
double false wall!!
0 0
Stephen Konxol
08/08/2017 12:00 AM
Plains
dont forget to put out your campires everyone!! unlocks feat
1 0
Stephen Konxol
08/07/2017 11:58 PM
Plains
boss destroyed! feat unlocked.... i'm alive!
3 0
RODRIGO rohero
08/07/2017 5:27 PM
Flying Machine (Specter)
It's all about timing
0 0
yeyo yeyopapa
08/07/2017 5:19 PM
Plains
hi pals
0 0
Max The_Forerunner
08/07/2017 5:07 PM
Troupple Pond
4 0
Taco angie1056
08/07/2017 4:57 PM
Lost City
baaahh
1 0
JT 4Strong
08/07/2017 4:38 PM
Hall of Champions
just beat hall of chapions
0 0
Bangerman Banjerman
08/07/2017 1:52 PM
Tower of Fate (Specter)
me need gold
0 0
Anthony antman182
08/07/2017 12:38 PM
Lost City (Plague)
Why is mole knight called mole knight he should be called earth knight or flame knight
0 0
owen dolphinmaster7
08/07/2017 11:03 AM
Plains
this is pronounced sddsddffffv and written blahah
1 0
adam 1Groovyfamilywii
08/07/2017 11:01 AM
Hall of Champions (Plague)
i will destroy every pianting in the hall of champions
0 0
adam 1Groovyfamilywii
08/07/2017 10:18 AM
Explodatorium (Plague)
i cleard a room but this room im in is like HELL
0 0
adam 1Groovyfamilywii
08/07/2017 10:13 AM
Explodatorium (Plague)
this guy is is going down
0 0
Noah RooneySmith
08/07/2017 8:59 AM
Iron Whale (Specter)
Have not played this in a while. Glad to see the new updates!
1 0
ali Waffain
08/07/2017 8:42 AM
Tower of Fate (Specter)
specter knight is the best
7 0
Gavin BURK3S
08/07/2017 7:21 AM
Plains (Plague)
(*_*)
3 0
RODRIGO rohero
08/06/2017 8:51 PM
Explodatorium (Specter)
when you love this level and hated it at the same time
2 0
adam 1Groovyfamilywii
08/06/2017 7:47 PM
Explodatorium (Plague)
you update the game
0 0
adam 1Groovyfamilywii
08/06/2017 7:46 PM
Explodatorium (Plague)
at the first checkpoint go to the right top then birst then there will be a ladder climb the ladder
0 0
The Fedora verdyestrada
08/06/2017 7:43 PM
Village
3 0
adam 1Groovyfamilywii
08/06/2017 7:39 PM
Explodatorium (Plague)
i love plague knight
0 0
Ricky CrickyJ
08/06/2017 7:39 PM
Plains
Watch out for spooky skeletons! (There's two...)
3 1
Chiefkief ChieferKiefer
08/06/2017 6:14 PM
Pridemoor Keep
2 0
ηαρρα naps-included
08/06/2017 6:13 PM
Clockwork Tower (Specter)
best music <3
0 0
Jordan Rebecca91Whiskey
08/06/2017 6:03 PM
Armor Outpost
No weopons here.
0 0
The Fedora verdyestrada
08/06/2017 5:38 PM
Plains
Late to the party but Shovel Knight begins! Time to steel thy shovel!
1 0
Big Daddy PuzzleFactory
08/06/2017 2:46 PM
Pridemoor Keep
0 0
joey chiefcool9
08/06/2017 2:18 PM
Tower of Fate: Ascent
.
0 0
joey chiefcool9
08/06/2017 2:18 PM
Tower of Fate: Ascent
too HARD!!
0 0
joey chiefcool9
08/06/2017 1:28 PM
Tower of Fate: Ascent
1 0
joey chiefcool9
08/06/2017 1:17 PM
Tower of Fate: Ascent
1 0
omega JHeart01
08/06/2017 9:00 AM
The Lich Yard
I BEAT SPECTER KINGHT FINALY
1 0
omega JHeart01
08/06/2017 8:56 AM
The Lich Yard
0 0
omega JHeart01
08/06/2017 8:54 AM
The Lich Yard
HE WAS DOWN TO 1 UP 1 HP AND I WAS AT 3 AND HE KILLED ME FUC U SPECTER KNIGHT FUC U
1 0
omega JHeart01
08/06/2017 8:46 AM
The Lich Yard
0 0
Tommy fumarola
08/06/2017 7:15 AM
Torre del Hado (Specter)
Este juego es lo mejor
0 0
Travis AnaRandolph
08/06/2017 3:50 AM
Pridemoor Keep (Specter)
go left first for a secret!
0 0
Woppo.Jr LeahDaveJoey
08/06/2017 2:14 AM
Tower of Fate (Specter)
3 0
michael Spaceballs2
08/05/2017 8:46 PM
Tower of Fate: Entrance
0 0
michael Spaceballs2
08/05/2017 8:45 PM
Tower of Fate: Entrance
blacknight had a red bull (because wings)
4 0
shaker shaker7890
08/05/2017 5:28 PM
Pridemoor Keep
2 0
Andy LUBUofDW
08/05/2017 5:14 PM
Plains
starting my body swapped run
1 0
Loopy LoopMan63
08/05/2017 1:41 PM
Explodatorium
pqkbnagjrjwjfkdj
1 0
omega JHeart01
08/05/2017 1:31 PM
Clockwork Tower (Specter)
YOU SHALL NOT PASS
0 0
Woppo.Jr LeahDaveJoey
08/05/2017 1:23 PM
Tower of Fate (Specter)
I've had this version for 3 hours and already im further than i am in the shovel of hope version!
1 0
nater pancakes98
08/05/2017 12:16 PM
The Lich Yard (Specter)
found room
0 0
Noah NoahLee7
08/05/2017 11:19 AM
Tower of Fate (Specter)
Im the best
0 0
Q nallfamily
08/05/2017 10:43 AM
Explodatorium (Plague)
I hate the rats! @#$% them
2 0
Jonathan shanoa123
08/05/2017 10:14 AM
Ballena de Hierro
0 0
Beckett snekfam
08/05/2017 7:09 AM
Pridemoor Keep
1 0
Lucavi Legend-of-Lucavi
08/04/2017 6:51 PM
Plains
1 0
charly osito1928
08/04/2017 5:06 PM
Charca Truchanzana
Te la creiste wee
3 0
TREYTREY#$ Mr.Waffle24
08/04/2017 4:29 PM
Clockwork Tower
still stuck on tinker knight
0 0
Bangerman Banjerman
08/04/2017 3:54 PM
Plains (Plague)
1 0
Travis AnaRandolph
08/04/2017 11:16 AM
Tower of Fate (Specter)
da kiss of death
4 0
LoganSquid MrSplashnDash
08/04/2017 7:06 AM
The Lich Yard
3 1
Rick Echopepper
08/03/2017 11:18 PM
Bottomless Quarry (Plague)
This level's so great; awesome bomb jumps & Mole Knight's toe-tapping theme :D
0 0
weirdnwild weirdnwild91
08/03/2017 9:55 PM
Explodatorium
3 0
Kaden Blazemaster2004
08/03/2017 8:13 PM
Encounter - Phantom Striker
I really shouldntve had so much trouble with that boss before, he's so much worse in specter quest
1 0
Beckett snekfam
08/03/2017 3:06 PM
Iron Whale (Specter)
laaaaaa
0 0
Landon Landon1608
08/03/2017 2:06 PM
Village (Plague)
1 0
AJrenalin AJax0007
08/03/2017 1:45 PM
Explodatorium
3 0
henrrique pudim84
08/03/2017 12:38 PM
Torre do Destino: Entrada (Specter)
eu derrotei o black knight
0 0
Ephraim!$$ theE-Man2.0
08/03/2017 12:05 PM
Pridemoor Keep
0 0
Travis AnaRandolph
08/03/2017 11:52 AM
Tower of Fate (Specter)
i bought the most expensive clothes in the game!!!!!
4 0
Boss Man Caravan25
08/03/2017 10:34 AM
Flying Machine (Specter)
now that is what i call cloud control
0 0
Boss Man Caravan25
08/03/2017 10:02 AM
Lost City (Specter)
i would dig your grave but we're already there
0 0
Monnie SkullKid3D2
08/03/2017 9:45 AM
Plains (Specter)
playing new game plus, and dang, the Plains never been this intense.
3 0
Quimarda Quimarda
08/03/2017 9:07 AM
Torre del Hado (Specter)
0 0
fazbear freddyfazbeargm
08/03/2017 12:17 AM
Campiña
2 0
Four eyes Blastbox22
08/02/2017 10:06 PM
Tower of Fate: Entrance (Specter)
If you run low on Darkness, hit Black Knight and Terrorpin's shots! They give out Darkness!
1 0
daddy iceberg321
08/02/2017 9:48 PM
The Lich Yard
0 0
Four eyes Blastbox22
08/02/2017 9:37 PM
The Lich Yard (Specter)
Even your dash slash can put out flames! Don't be afraid, just do it!
0 0
E.ismycity Thatoneguy2003
08/02/2017 7:29 PM
Pridemoor Keep
2 0
Boss Man Caravan25
08/02/2017 7:08 PM
Pridemoor Keep (Specter)
in the pit where you belong
0 0
Boss Man Caravan25
08/02/2017 6:49 PM
Tower of Fate (Specter)
invade my castle you get the sycth
2 0
Heisenberg Heisenberg3556
08/02/2017 5:59 PM
Village
Dean poop
2 0
argonos argenisyael
08/02/2017 5:28 PM
Fortaleza del Orgullo (Plague)
wooo
0 0
Monnie SkullKid3D2
08/02/2017 5:07 PM
Tower of Fate: ???? (Specter)
Reize I'm so sorry :'-(
5 0
Monnie SkullKid3D2
08/02/2017 4:29 PM
Tower of Fate: ???? (Specter)
The end of a journey is the start of another, I wonder if I can go left here...
0 0
Finn finsterme
08/02/2017 3:40 PM
Explodatorium (Specter)
I LOVE THIS GAME!
0 0
Boss Man Caravan25
08/02/2017 2:48 PM
Explodatorium (Specter)
your science magic is no match for me
0 0
adam 1Groovyfamilywii
08/02/2017 11:50 AM
Tower of Fate: ????
you can reflect the enchantresses magic even when she is in the air
1 0
adam 1Groovyfamilywii
08/02/2017 11:45 AM
Tower of Fate: ????
i will get revenge speter knight senserly the enchantress
0 0
adam 1Groovyfamilywii
08/02/2017 11:38 AM
Tower of Fate: ????
i died
0 0
adam 1Groovyfamilywii
08/02/2017 11:30 AM
Tower of Fate: ????
i,m failing on the enchantress
0 0
adam 1Groovyfamilywii
08/02/2017 11:27 AM
Tower of Fate: ????
shovel drop on the moveing blocks to destroy them
0 0
adam 1Groovyfamilywii
08/02/2017 11:22 AM
Tower of Fate: ????
0 0
adam 1Groovyfamilywii
08/02/2017 11:22 AM
Tower of Fate: ????
0 0
adam 1Groovyfamilywii
08/02/2017 11:16 AM
Plains
i got monney for beating black knight even thow i allready beat him im also on the tower of fate
1 0
Travis AnaRandolph
08/02/2017 9:24 AM
Tower of Fate: Entrance (Specter)
gets too meddle of tower of fate sister turns it of fffff
1 0
Edison Edison_Tse
08/02/2017 8:31 AM
Tower of Fate: Entrance
Second comment
1 0
Quikster Quikster11
08/02/2017 6:37 AM
Forest of Phasing
0 0
Hanna HannaBanano
08/02/2017 3:43 AM
Finca de Liches
1 0
Wii Master KonuroSilver
08/01/2017 8:25 PM
Village
I've been away from this game for too long! When was this gender swap become a thing! It's awesome!!
6 0
Hannibal HannahEcho
08/01/2017 7:32 PM
Lost City
ffffcfffccggv
1 0
Four eyes Blastbox22
08/01/2017 4:41 PM
Lost City (Specter)
React fast! There's a chest in one of these walls!
0 0
h3h3 no.1blockhead
08/01/2017 3:23 PM
Tower of Fate: ???? (Specter)
if you pause it says back to tower but you're already in the tower
3 0
Liam SrLeopardo
08/01/2017 2:43 PM
Villa
i hate tinker knight
0 0
ker-plop ker-plop
08/01/2017 2:42 PM
The Lich Yard (Plague)
He's tough, but not impossible to earn "Untouchable" with.
0 0
uneven alvino32
08/01/2017 12:42 PM
Torre del Hado: Entrada
solo es cuestion de mirar la lluvia
0 0
Emery master-of-walrus
08/01/2017 11:12 AM
Iron Whale
tttttt
0 0
Travis AnaRandolph
08/01/2017 9:59 AM
Clockwork Tower (Specter)
very dark and spooky
0 0
Travis AnaRandolph
08/01/2017 9:42 AM
The Lich Yard (Specter)
0 0
Nixon 111111nixon
08/01/2017 8:53 AM
The Lich Yard (Plague)
0 0
coolmike wandadavid
08/01/2017 6:44 AM
Plains
5 0
Erossore Erossore
07/31/2017 7:10 PM
Tower of Fate: Entrance (Specter)
I did it! Oh my gosh YES!
0 0
Enigma TheUnseenEnigma
07/31/2017 6:15 PM
Plains
me is glich
1 0
Matthew Arcticcanine
07/31/2017 5:19 PM
Plains
nigggggggggrelto
5 0
Nesty 3 Nesty3
07/31/2017 12:26 PM
Campiña
5 0
Rich rcromero
07/31/2017 11:09 AM
Plains
love this game so much
3 0
Preston Lilmac08934
07/31/2017 10:39 AM
Explodatorium
giant nuts are chasing me
0 0
old jack jackmrowe
07/31/2017 10:16 AM
The Lich Yard (Plague)
to use burst hold the attack button
0 0
henrrique pudim84
07/31/2017 10:09 AM
O Jardim do Espectro (Specter)
a sala secreta!
0 0
PoorKenny JoeFubar
07/31/2017 5:30 AM
Village
4 0
Tenoshi JPLanh
07/31/2017 3:25 AM
Hall of Champions
be sure to use the orb hidden in the wall to kill the ghost for gems
0 0
Tenoshi JPLanh
07/31/2017 2:44 AM
Armor Outpost
bought the dynamo armor. got to say, im diggin the instacharge even if it doesnt damage an enemy.
0 0
Nick562 vikings562
07/30/2017 11:42 PM
Explodatorium
1 0
Sergio sjunior986
07/30/2017 6:59 PM
Planícies
1 0
Tyler ttrott
07/30/2017 6:47 PM
Pridemoor Keep
1 0
gael ferminf
07/30/2017 5:23 PM
Iron Whale
plagueknight as a girl whould love mona so they are lez
1 0
paul Mario3607
07/30/2017 4:45 PM
Flying Machine
0 0
Erik buddhaiswise
07/30/2017 4:34 PM
Plains (Specter)
why do i keep dieing!?
4 0
Thomas snakethegreat
07/30/2017 4:34 PM
Tower of Fate: Ascent
This is way harder as plauge knigt
2 0
adam 1Groovyfamilywii
07/30/2017 3:57 PM
Stranded Ship
i,m just here to get the war horn
0 0
DA Palms DApalms
07/30/2017 3:06 PM
Stranded Ship
easy af
1 0
Cullen PurpleFinn00
07/30/2017 1:42 PM
Armor Outpost
Clockwork Tower is a pain in the a$$!
0 0
MattShroom Citren64
07/30/2017 1:27 PM
Tower of Fate: Entrance
Pro-Tip: Do not, under any circumstance, play this co-op.
0 0
adam 1Groovyfamilywii
07/30/2017 12:24 PM
Flying Machine
0 0
adam 1Groovyfamilywii
07/30/2017 12:20 PM
Flying Machine
propelor knight is so hard
0 0
Uziel GuerreroUMS
07/30/2017 11:44 AM
Tower of Fate (Specter)
I had forgotten about the Specter and Plague Knight update. Let's go!
3 0
kevin braydenrocks1029
07/30/2017 9:40 AM
Tower of Fate (Specter)
2 0
gael ferminf
07/30/2017 9:33 AM
Lost City
I SHOULD GET MY OWN DLC
0 0
gael ferminf
07/30/2017 9:32 AM
Lost City
is this my wife
1 0
Paxton Callmepaxton
07/30/2017 9:11 AM
The Lich Yard
1 0
Deena Gilbert-BagEnd
07/30/2017 5:50 AM
Tower of Fate: Entrance (Specter)
ffffff
2 0
Andy LUBUofDW
07/29/2017 11:50 PM
Bottomless Quarry (Plague)
man its like having item number 2
0 0
gael ferminf
07/29/2017 8:48 PM
Plains
i did a cheati cant die and money comes to me
1 0
Mom LisaRodens
07/29/2017 6:21 PM
Plains (Plague)
hi
3 0
J unavires juansebastian03
07/29/2017 5:24 PM
Iron Whale
carlos was here
0 0
zackattack thrashkid
07/29/2017 5:19 PM
The Lich Yard (Specter)
spoil alert this game is awsome
2 0
jacob MutantZombie297
07/29/2017 4:00 PM
Plains (Specter)
masta i now hate you specter knight is cool
1 0
Mac Quietlittleman12
07/29/2017 3:03 PM
Pridemoor Keep
Get Rekt!
2 0
Tyler ttrott
07/29/2017 2:05 PM
Flying Machine (Specter)
0 0
Weegee xman1870
07/29/2017 11:56 AM
Explodatorium (Plague)
0 0
Lukie LDF7492
07/29/2017 11:30 AM
The Lich Yard
2 0
gael ferminf
07/29/2017 11:26 AM
Iron Whale (Specter)
My friend is a red crab that has lots of money
0 0
gael ferminf
07/29/2017 11:23 AM
Iron Whale (Specter)
there is a way to kill the evil woman she must kiss me
0 0
gael ferminf
07/29/2017 11:20 AM
Iron Whale (Specter)
yes its dead
1 0
gael ferminf
07/29/2017 11:19 AM
Iron Whale (Specter)
I need to get kill that fish well just call spector knight
0 0
Drew D Dalek06
07/29/2017 7:27 AM
Tower of Fate: ???? (Specter)
Take that reize aka boomerang kid
1 0
adam 1Groovyfamilywii
07/28/2017 7:43 PM
Armor Outpost
Hello guys.
0 0
Logan Wii3Boyz
07/28/2017 6:50 PM
Stranded Ship
potatos
0 0
Francisco frank_cuate44
07/28/2017 5:49 PM
Armería
Team Fortress 2 in a nutshell
0 0
fire foxy bonefiref
07/28/2017 5:00 PM
Plains
shovel knight is a great game
6 0
gael ferminf
07/28/2017 3:19 PM
Dirt Clod Dash
I hate doing this
1 0
harout theevilchin
07/28/2017 3:11 PM
Village
smd
2 0
el chanto Pachas123456
07/28/2017 1:49 PM
Máquina Voladora
soy pro
0 0
ma mii liam190000
07/28/2017 10:14 AM
Clockwork Tower
#tinker knight mech op
0 0
Ralph Coulterfamily
07/28/2017 9:39 AM
Plains (Plague)
0 0
Eris backlyte
07/28/2017 8:55 AM
Armor Outpost
i love this game
0 0
Meat wmjsimmons
07/28/2017 8:11 AM
Iron Whale
Any tips for this fish?
1 0
ppires eldergruff48
07/28/2017 6:49 AM
Encounter - Black Knight
HI
0 0
ppires eldergruff48
07/28/2017 6:38 AM
Encounter - Black Knight
0 0
Nene Nenethegreat
07/28/2017 6:25 AM
Encounter - Reize
bbbb
0 0
Too[LAZY] rabinnh
07/28/2017 4:28 AM
Plains (Specter)
jeez the spectre run is hard
1 0
weirdnwild weirdnwild91
07/27/2017 10:26 PM
Iron Whale
2 0
adam 1Groovyfamilywii
07/27/2017 6:56 PM
The Lich Yard (Plague)
i beat speter of tornement
0 0
ben rfsmaster
07/27/2017 5:52 PM
The Lich Yard
who here has the switch?!?!:D
2 0
adam 1Groovyfamilywii
07/27/2017 5:41 PM
Tower of Fate: Entrance (Specter)
the tower of fate is so hard
4 0
Andy LUBUofDW
07/27/2017 5:21 PM
Flying Machine
huh? so i should have know the dagger could be used like that
0 0
Andy LUBUofDW
07/27/2017 5:06 PM
Flying Machine
that feel when you break a check point you didn't mean to break
0 0
Max gomaskus
07/27/2017 4:34 PM
Plains
i just got this game cant wait to explore furthur
2 0
adam 1Groovyfamilywii
07/27/2017 4:19 PM
Flying Machine (Specter)
this is so hard
0 0
adam 1Groovyfamilywii
07/27/2017 4:16 PM
Flying Machine (Specter)
i,m lovin being speter knight
1 0
Trevor TrevorGonzalez00
07/27/2017 2:50 PM
The Lich Yard (Specter)
2 0
KingZombie TheOG.KingZombie
07/27/2017 2:39 PM
Explodatorium (Specter)
WOW! This is basically a whole new game! AWESOME!!!
2 0
legoflash TheLegoFlash
07/27/2017 8:29 AM
Plains
that is the skull of my enamy
1 0
The Fam 14TheFam
07/27/2017 8:05 AM
Village
toasters
8 1
Hunter G HunterG
07/27/2017 5:59 AM
The Lich Yard
3 0
Jackson KeithFamilyTeam
07/26/2017 7:06 PM
Troupple Pond
he dances
7 0
KingZombie TheOG.KingZombie
07/26/2017 6:50 PM
Encounter - Black Knight (Plague)
WOOOOOOOOO! Percy on deck! (I love this game!)
1 0
Axel chaoscontrol567
07/26/2017 6:11 PM
Iron Whale (Specter)
4 0
Axel chaoscontrol567
07/26/2017 6:08 PM
Iron Whale (Specter)
STUPID MISSILES
1 0
Axel chaoscontrol567
07/26/2017 6:06 PM
Iron Whale (Specter)
r.i.p. specter knight..... again
1 0
Axel chaoscontrol567
07/26/2017 6:01 PM
Iron Whale (Specter)
you say that like you have a choice...
0 0
Axel chaoscontrol567
07/26/2017 5:57 PM
Iron Whale (Specter)
FAINALLY
0 0
Axel chaoscontrol567
07/26/2017 5:56 PM
Iron Whale (Specter)
how do i get pink diamond?
2 1
Axel chaoscontrol567
07/26/2017 5:55 PM
Iron Whale (Specter)
r.i.p.
0 0
Cro cro935
07/26/2017 5:43 PM
Stranded Ship
boo!
1 0
pull pullarfamily
07/26/2017 4:48 PM
Plains
how do you get past the bubbles
1 0
Axel chaoscontrol567
07/26/2017 4:40 PM
Tower of Fate (Specter)
i liked raize better before
3 0
Yay pixieRstix
07/26/2017 4:35 PM
Tower of Fate (Specter)
sup
1 0
R.I.P. MV Fuego10
07/26/2017 3:21 PM
Plains (Plague)
Wow,the cringe.I'm just Veryling these posts because of sarcasm XD
5 0
QereweYT MarioMadness22
07/26/2017 3:07 PM
Village (Plague)
Soft Locked by jumping behind the woman that brings you down to the "real" village
6 0
Mac Quietlittleman12
07/26/2017 1:15 PM
Pridemoor Keep
GET REKT!!!
0 0
Fabrizio Fabriziov14
07/26/2017 12:08 PM
Armería
:v
0 0
thief456 Pendra007
07/26/2017 11:00 AM
Plains (Specter)
just defitted black night
2 0
thief456 Pendra007
07/26/2017 10:41 AM
Plains (Specter)
argh!!! have to do level all over again!!!!!
1 0
thief456 Pendra007
07/26/2017 10:24 AM
Plains (Specter)
0 0
thief456 Pendra007
07/26/2017 10:22 AM
Plains (Specter)
scelitonsr anoyng
2 0
Addictz fireace504
07/26/2017 7:32 AM
Plains (Specter)
I have not played this game in a year
1 0
thomas jorgfam
07/26/2017 7:18 AM
Tower of Fate: ????
day 875 still did not get past stage 1
1 0
Kafkat Kafkat
07/26/2017 6:36 AM
Plains (Specter)
yup i do
1 0
Mac Quietlittleman12
07/26/2017 6:33 AM
Plains (Specter)
Sup
2 0
Bruskboys bruskotter4
07/26/2017 6:24 AM
The Lich Yard
Replaying shovel of hope! trying to get 100% this time.
0 0
Andy LUBUofDW
07/25/2017 10:11 PM
Armor Outpost
i got treasure knight! he reminds me of a big daddy
0 0
Dore superdore
07/25/2017 8:23 PM
Explotatorium
le patie el trasero a se boss
0 0
Nick562 vikings562
07/25/2017 8:20 PM
Iron Whale
I love this game
4 0
Dore superdore
07/25/2017 7:43 PM
Charca Truchanzana
q tipo o cosa mas simpatica jeje
0 0
zxenokight zackattack1506
07/25/2017 7:09 PM
Iron Whale
dis game sooooo gots lots the harsheeeees
1 0
Preston littlejohn81
07/25/2017 4:09 PM
Rematch: King Knight
I did this with one hit-point left!!!
0 0
Logan Wii3Boyz
07/25/2017 2:34 PM
Plains
youre telling me
3 0
gael ferminf
07/25/2017 2:33 PM
The Lich Yard (Specter)
Fun game
0 0
adam 1Groovyfamilywii
07/25/2017 2:33 PM
The Lich Yard (Plague)
i cant finish
0 0
Jorkums 22tfsociety
07/25/2017 2:27 PM
Iron Whale
3 0
josiah daffodels
07/25/2017 11:44 AM
Flying Machine
,nmb gGBCHHGGVVJ
0 0
Will feutete
07/25/2017 10:43 AM
Village
nailed specter knight!
1 0
zackattack thrashkid
07/25/2017 9:55 AM
Pridemoor Keep
2 0
Carlos Armijo_Family
07/25/2017 9:55 AM
Tower of Fate (Specter)
I suck at this game this guy wants to play (SPOILER ALERT)
2 0
Carlos Armijo_Family
07/25/2017 9:23 AM
Plains (Specter)
Hello
0 0
jaden chingfamily
07/25/2017 9:10 AM
Tower of Fate (Specter)
And i am boomerang boy Reize
2 0
Dore superdore
07/25/2017 9:04 AM
Finca de Liches
casi lo mato solo uno y yo tenia 3 y memato de un toque >:(
1 0
Kyler Bears4ever
07/25/2017 9:00 AM
Flying Machine (Plague)
lol i defeated him then fell in the hole
0 0
Kyle ezs1622
07/25/2017 8:02 AM
The Lich Yard (Plague)
Hi
1 0
gbill gbillinger123
07/25/2017 4:51 AM
Pridemoor Keep (Plague)
Playing trough as plauge knight for first time and its as hard as cleaning my dogs droppings
1 0
Karatnt karatnt
07/24/2017 9:51 PM
Village
how do i do the other campains
1 0
Ethan ethanshabba
07/24/2017 9:15 PM
Tower of Fate (Specter)
first butt
3 0
Triston triston2204
07/24/2017 8:38 PM
Plains
just beat the boss also anyone know howto do multiplayer with the new update
2 1
Poliver Polivers
07/24/2017 7:30 PM
Torre Mecánica (Plague)
bombas para YA!!!
0 0
ricky lil_rt2
07/24/2017 6:35 PM
Tower of Fate (Specter)
spector knight is toasty (toasty = epic)
5 0
Poliver Polivers
07/24/2017 4:23 PM
Piscibosque (Plague)
una caña pa pescar no?ji ji ji
0 0
rory rorasaur11
07/24/2017 2:37 PM
The Lich Yard
1 0
daddy hyp3r10n
07/24/2017 2:10 PM
Lost City (Specter)
5000 coins!!! But no way to get more):
0 0
Eve TrishaElric
07/24/2017 1:52 PM
The Lich Yard
4 0
taran T2005X
07/24/2017 1:45 PM
Hall of Champions
this was a waste of money
0 0
Flea dcweas
07/24/2017 12:32 PM
Village (Plague)
ive played this game on ps4 before but im not used to the controls on wii
2 0
patrick bowserpat1
07/24/2017 11:35 AM
Rematch: King Knight
did it!
0 0
patrick bowserpat1
07/24/2017 11:12 AM
Lost City (Specter)
first try... lol
0 0
zackattack thrashkid
07/24/2017 10:50 AM
The Lich Yard (Specter)
THIS GAME IS SO HARD!!!
1 0
patrick bowserpat1
07/24/2017 9:54 AM
Plains
easy
0 0
Hayden Creepister101
07/24/2017 9:03 AM
Hall of Champions
0 0
Juz juz600
07/24/2017 8:48 AM
Iron Whale
me and my brother are playing and getting more angry then mentaly possible
1 0
patrick bowserpat1
07/24/2017 8:12 AM
Tower of Fate (Specter)
Can't wait for the final boss! Wonderful game!
5 0
xStatic BIGHEATON6
07/24/2017 7:18 AM
Clockwork Tower
Its the Shadow of The Tinker Knight!
0 0
daboy DaBoy2
07/24/2017 7:08 AM
Forest of Phasing
i am da 1 da 1 i dont need a gun to get respect cause i am da 1 da 1!
0 0
Lukie LDF7492
07/24/2017 6:44 AM
Village
4 0
Brian BCWerewolf
07/24/2017 5:30 AM
Village (Plague)
how do you find the trouple king?
1 1
Andy LUBUofDW
07/23/2017 11:01 PM
Village
got to town love the place so far.
1 0
bb evan bbevan17
07/23/2017 10:44 PM
Clockwork Tower
amibo for life
1 0
Hannah Higuraii
07/23/2017 8:10 PM
The Lich Yard
Finally bought this game. It's so cute!
2 0
Dore superdore
07/23/2017 8:09 PM
Fortaleza del Orgullo
lo ise 2do villano muerto
0 0
Dore superdore
07/23/2017 7:40 PM
Fortaleza del Orgullo
osea q este tipo pasa por esto para llegar a su alcoba? XD
0 0
Dore superdore
07/23/2017 7:25 PM
Villa
/e dance
1 0
Dore superdore
07/23/2017 7:24 PM
Villa
nos podemos parar en la mujer q tiene dos cubetas jeje
0 0
Dore superdore
07/23/2017 7:21 PM
Villa
q es el belico?
1 0
Dore superdore
07/23/2017 7:12 PM
Campiña
lo derrote ala 4 XD
0 0
Dore superdore
07/23/2017 7:11 PM
Campiña
q duro esta
0 0
Dore superdore
07/23/2017 7:03 PM
Campiña
porq
0 0
Dore superdore
07/23/2017 6:43 PM
Campiña
perdi mis recompensas en el foso XD
0 0
Dore superdore
07/23/2017 6:41 PM
Campiña
casi muero esta perfecto lo amo me gusta
0 0
Dore superdore
07/23/2017 6:36 PM
Campiña
hola a todos
2 0
Daddy TheUmaster
07/23/2017 5:56 PM
Iron Whale (Specter)
Ughh, water levels- amiright?!
2 0
Edward 60drawde
07/23/2017 2:02 PM
Tower of Fate: Entrance
2 0
zackattack thrashkid
07/23/2017 1:01 PM
Plains (Specter)
just defeated black night
2 0
adam 1Groovyfamilywii
07/23/2017 11:50 AM
Tower of Fate (Specter)
thanks for the wisp
5 0
Theopold!? tyoier
07/23/2017 7:28 AM
Tower of Fate (Specter)
2 0
Dennis Dennis.16
07/23/2017 7:18 AM
Flying Machine
Everyone's complaining about this level making them rage quit. I love it. It might be my favorite.
1 1
King Keat Ilovem-craft
07/23/2017 6:25 AM
The Lich Yard (Plague)
too hard!
0 0
jjx jjulianx
07/22/2017 11:25 PM
Plains
4 0
Seth rrplilbro
07/22/2017 7:16 PM
Plains
On the 1st day I already on the last level! So easy and fun!
1 0
adam 1Groovyfamilywii
07/22/2017 7:07 PM
Plains (Plague)
3 0
jabez jjspheal
07/22/2017 6:58 PM
Flying Machine (Plague)
The esseances look like dragonballs!
1 0
jabez jjspheal
07/22/2017 6:48 PM
Flying Machine (Plague)
The sparker powder is so op at times!
1 0
NoiZybockr spiffyclover05
07/22/2017 1:39 PM
Iron Whale
why is this game so hard
2 0
ch.toad chiquitin2009
07/22/2017 11:21 AM
La Ciudad Perdida (Plague)
es como si fuera ayer
2 0
ch.toad chiquitin2009
07/22/2017 11:13 AM
Armería (Plague)
1 0
xStatic BIGHEATON6
07/22/2017 9:18 AM
Plains (Specter)
guys theres a cheat code!
1 0
xStatic BIGHEATON6
07/22/2017 7:06 AM
Tower of Fate (Specter)
i beat the game in less than half a day...
2 0
Elijah coolioe12
07/21/2017 11:22 PM
Clockwork Tower
tis is fun but hard
1 0
Kyler Bears4ever
07/21/2017 10:53 PM
The Lich Yard (Specter)
1 0
Kyler Bears4ever
07/21/2017 10:47 PM
The Lich Yard (Specter)
last time anything was this hard it was 1969
1 0
Kyler Bears4ever
07/21/2017 10:28 PM
The Lich Yard (Specter)
when yuou die so many times you have no gold to lose
0 0
Dank Memer watergod34
07/21/2017 9:15 PM
Tower of Fate (Specter)
there are jolly rancher poptarts
5 0
xStatic BIGHEATON6
07/21/2017 8:38 PM
Iron Whale (Specter)
Im sick and contagious....
1 1
Anthony antman182
07/21/2017 7:09 PM
Tower of Fate: Entrance
4 0
Anthony antman182
07/21/2017 7:01 PM
Tower of Fate: Entrance
Ohhhhhhhh were halfway there!!!
0 0
spongebob★ diegocampos08
07/21/2017 5:51 PM
Explodatorium (Specter)
gotta run fast
1 0
Spankaro Spyro4life
07/21/2017 5:43 PM
Flying Machine (Plague)
Hardest Checkpointless stage EVER!!
1 0
shadowhven Warriorssfyhj
07/21/2017 5:33 PM
Tower of Fate (Specter)
I LOVE the dark acolyte. fav charater <3
4 0
Jake DeathlyxSmash553
07/21/2017 4:36 PM
Plains (Specter)
specter is op
1 0
Bruce Jr bruce-can-draw
07/21/2017 3:46 PM
Plains (Specter)
0 0
Bruce Jr bruce-can-draw
07/21/2017 3:38 PM
Plains (Specter)
|=(
2 0
fushia fuschia03
07/21/2017 3:25 PM
Plains
1 1
Quincy blackbird1030
07/21/2017 2:21 PM
Village (Plague)
Best game ever!
2 0
mariosjk mariosjk
07/21/2017 1:29 PM
Clockwork Tower (Specter)
time to kill my favorite boss
1 0
mariosjk mariosjk
07/21/2017 1:07 PM
Flying Machine (Specter)
time to rage
3 0
William mari02608
07/21/2017 11:05 AM
Pridemoor Keep
i just did the finishing blow with a fishing rod LOL ;)
2 0
Cullen PurpleFinn00
07/21/2017 10:25 AM
Pridemoor Keep
Pridemoor CHECK!
0 0
xStatic BIGHEATON6
07/21/2017 9:29 AM
Iron Whale (Specter)
Almos done with donovan / Specters game
2 0
Mark MarkBooker
07/21/2017 3:52 AM
Plains (Plague)
2 0
bb ultimatefearguy
07/20/2017 8:16 PM
Tower of Fate: Entrance
nooooooo
2 0
bb ultimatefearguy
07/20/2017 8:11 PM
Tower of Fate: Entrance
noooo
1 0
señor Jerkstoore
07/20/2017 7:26 PM
Explodatorium
7 0
Ryan snakeboy22222
07/20/2017 7:10 PM
Tower of Fate: Entrance
1 0
Arther BubbleNuggetPlaz
07/20/2017 6:43 PM
Village
0 0
Isaac1703 isaac170304
07/20/2017 6:41 PM
Tower of Fate (Specter)
2 0
im short meshort
07/20/2017 5:19 PM
Flying Machine (Plague)
Yes!! I did it!!! I FINALLY made it to the boss!!!
0 0
im short meshort
07/20/2017 5:17 PM
Flying Machine (Plague)
Almost to the boss! Now how to beat this room...
0 0
im short meshort
07/20/2017 5:02 PM
Flying Machine (Plague)
Why is this room like this?!
0 0
mariosjk mariosjk
07/20/2017 4:35 PM
Iron Whale (Plague)
lol first post here
0 0
Isaac1703 isaac170304
07/20/2017 4:18 PM
Pridemoor Keep (Specter)
0 0
Trevor TrevorGonzalez00
07/20/2017 2:29 PM
Tower of Fate (Specter)
1 0
BrentBuddy KrazyKiwi707
07/20/2017 2:25 PM
Tower of Fate (Specter)
FRIED CHILI CHEESE DOGS
3 0
Logan millerbrine
07/19/2017 7:22 PM
Plains (Specter)
1 0
Logan millerbrine
07/19/2017 6:46 PM
Plains
Shovel Knight is best game
5 0
two face Alexrocksmore
07/19/2017 5:55 PM
Plains
first
2 0
Monnie SkullKid3D2
07/19/2017 5:12 PM
Tower of Fate: Entrance (Specter)
hmm... why is there that one platform there? Perhaps there might be a gift there...
1 0
mariosjk mariosjk
07/19/2017 5:06 PM
Tower of Fate: ????
I hope you have the phase locket, you're gonna need it
0 0
kevin braydenrocks1029
07/19/2017 1:05 PM
Armor Outpost
i defeated nightmare Raize in speacter kight mode
0 0
im short meshort
07/19/2017 12:30 PM
The Lich Yard (Plague)
The ghost of inSPECTER Gadget is here!
0 0
im short meshort
07/19/2017 12:29 PM
The Lich Yard (Plague)
So hard! Specter: Protip: Get good. Also throw bombs. And now, inSPECTER Gadget!
0 0
im short meshort
07/19/2017 11:42 AM
The Lich Yard (Plague)
Meow.
0 0
Isaac1703 isaac170304
07/19/2017 11:19 AM
The Lich Yard (Specter)
2 0
Isaac1703 isaac170304
07/19/2017 10:54 AM
Pridemoor Keep (Specter)
0 0
kerm kerm_bot
07/18/2017 9:24 PM
Troupple Pond (Plague)
this game is so fun. i hope they don't close down miiverse
6 0
isaac IsaacA2005
07/18/2017 7:47 PM
Iron Whale (Specter)
hi
2 0
Alex Beemainframe
07/18/2017 2:05 PM
The Lich Yard
Almost got the damned a hole
1 0
im short meshort
07/18/2017 1:22 PM
Plains (Plague)
Help! I don't know how to bomb burst!
7 0
Gianluca Camperboss
07/18/2017 12:38 PM
Tower of Fate (Specter)
Almost done specter of torment!!!
3 0
wiiston wiiston
07/18/2017 12:32 PM
Tower of Fate: ???? (Specter)
donovan: reze you learned the achievement of flight! well done, im proud of-AHHHHHHH
3 0
wiiston wiiston
07/18/2017 12:21 PM
Tower of Fate: ???? (Specter)
you just past them XD
1 0
wiiston wiiston
07/18/2017 12:20 PM
Tower of Fate: ???? (Specter)
i wonder what would happen if i went this way? <---
1 0
wiiston wiiston
07/18/2017 11:55 AM
Tower of Fate (Specter)
ok got my levendery cloak and im going to kill the inchanteress and the last boss wish me luck
4 0
wiiston wiiston
07/18/2017 11:51 AM
Tower of Fate (Specter)
last boss is OMEGA REZE
5 0
wiiston wiiston
07/18/2017 11:44 AM
Tower of Fate (Specter)
i used jugement rush it helps even better than the coin thing
2 0
wiiston wiiston
07/18/2017 11:41 AM
Tower of Fate (Specter)
theres a grandma in the mirror if you hit it enough
8 0
Triball borneojungle
07/18/2017 11:37 AM
Armor Outpost
I can't wait for King Knight!
4 0
wiiston wiiston
07/18/2017 11:35 AM
Clockwork Tower (Specter)
FAVORITE BOSS AND SONG
1 0
wiiston wiiston
07/18/2017 11:32 AM
Clockwork Tower (Specter)
i missed this checkpoint and i died here
0 0
wiiston wiiston
07/18/2017 11:25 AM
Clockwork Tower (Specter)
i used jugement rush and guess where that got me?
2 1
Awesome.jr awesomebry21
07/18/2017 11:25 AM
Tower of Fate (Specter)
this is hard
2 0
wiiston wiiston
07/18/2017 11:19 AM
Clockwork Tower (Specter)
no way! i trademarked shovel knignt first shovel knight shovel knight shovel knight
0 0
wiiston wiiston
07/18/2017 11:02 AM
Explodatorium (Specter)
chest cats, my weakness (get hit the times your dead)
0 0
wiiston wiiston
07/18/2017 10:56 AM
Explodatorium (Specter)
zero darkness and A HALF WILL
0 0
wiiston wiiston
07/18/2017 10:54 AM
Explodatorium (Specter)
you can hit the drink things back up
2 0
wiiston wiiston
07/18/2017 10:46 AM
Iron Whale (Specter)
theres a red skull here, shhhhhhh
0 0
Judy gamefreak12
07/18/2017 9:56 AM
Tower of Fate (Specter)
the donovan code tho
4 0
Dank Memes sanmaster99
07/18/2017 9:50 AM
Pridemoor Keep
griffin r strong
2 0
Kate znombie
07/17/2017 7:45 PM
Armor Outpost
when you havent played in a while and forget buttons...
0 0
mariosjk mariosjk
07/17/2017 3:04 PM
Tower of Fate: Entrance
combining all of my least favorite elements into one stage
0 0
Dylmo Poon_Panzer
07/16/2017 6:48 PM
Lost City (Specter)
loving this expansion!
2 0
Alex Beemainframe
07/16/2017 5:49 PM
Pridemoor Keep
0 0
Todd sforzando95
07/16/2017 4:43 PM
Tower of Fate: ???? (Specter)
How to beat her when she just keeps hiding under the stage??
3 0
Todd sforzando95
07/16/2017 4:26 PM
Tower of Fate: Entrance (Specter)
Wait, does this joker think Enchantress is Shield Knight?
0 0
Todd sforzando95
07/16/2017 4:23 PM
Tower of Fate: Entrance (Specter)
Wouldn't be bad if the autoscroll speed was so slow...
1 0
dan lild0606
07/16/2017 4:00 PM
Plains
can anyone guess who my favorite character is
1 0
Brody bmjeanotte
07/16/2017 2:05 PM
The Lich Yard
ugh it is so hard
1 0
Andrew nmcowboy
07/16/2017 1:01 PM
Pridemoor Keep (Plague)
Hmm Hhmm
1 0
GeckoNinja bacon2317
07/15/2017 7:11 PM
The Lich Yard
Co-op is so hard
4 0
feraligatr MonsterShy
07/15/2017 6:18 PM
Pridemoor Keep
i'm not a witch!
1 0
andrew anppy1
07/15/2017 5:48 PM
Plains (Specter)
well im specter now
4 0
Ryan BS_Alliance
07/15/2017 5:44 PM
Tower of Fate (Specter)
i am sword knight!
2 0
Ryan BS_Alliance
07/15/2017 5:43 PM
Tower of Fate (Specter)
captain america
2 0
Ryan BS_Alliance
07/15/2017 5:30 PM
Tower of Fate (Specter)
hfhdghhgb
2 0
Ryan BS_Alliance
07/15/2017 5:18 PM
Tower of Fate (Specter)
3 0
Ryan BS_Alliance
07/15/2017 5:16 PM
Tower of Fate (Specter)
I BEAT SPECTER OF TORMENT
2 0
Ryan BS_Alliance
07/15/2017 4:58 PM
Tower of Fate: ???? (Specter)
anyone play shovel of hope?
1 0
Ryan BS_Alliance
07/15/2017 4:54 PM
Tower of Fate: ???? (Specter)
I did a trick,well fighting a demon!
2 0
jude judeCB
07/15/2017 3:27 PM
Explodatorium (Plague)
THIS MUSIC HAUNTS ME.
0 0
bullet coffeeshopwiiu
07/15/2017 12:56 PM
Plains
shovel?
1 0
Duff E.Duff
07/15/2017 12:44 PM
Tower of Fate: Entrance
I hate that gryphon......
1 0
Todd sforzando95
07/15/2017 12:00 PM
Clockwork Tower (Specter)
1 0
Todd sforzando95
07/15/2017 11:55 AM
Clockwork Tower (Specter)
0 0
john charzonia
07/15/2017 11:45 AM
Village
1 0
john charzonia
07/15/2017 11:33 AM
shortcut?
when you beat all bosses up to mole knight you can catapult from village to blacksmith baloon. cool!
0 0
Yeezus BigJim1286
07/14/2017 7:43 PM
Tower of Fate: Ascent
last level. wish me luck
1 0
max meepscar02
07/14/2017 5:18 PM
Explodatorium (Specter)
my attack button is not working HELP!!!!!!
3 0
Dylan pixelkingdylan
07/14/2017 4:46 PM
Plains
How to two player
1 0
graeme maguire1166
07/14/2017 12:00 PM
The Lich Yard
frickin impossible
4 0
dark pit Skylander617
07/14/2017 11:43 AM
Plains (Specter)
good game
2 0
Q nallfamily
07/14/2017 11:07 AM
Plains (Plague)
black knight is easy here but harder at the tower of fate
1 0
Q nallfamily
07/14/2017 11:03 AM
Plains (Plague)
goo garment is cool
3 0
erik erock25622
07/14/2017 10:03 AM
Tower of Fate (Specter)
i want my slaves
4 0
princess dragon45600
07/14/2017 9:14 AM
Clockwork Tower (Specter)
1 0
wifey wifeymetz15
07/14/2017 8:40 AM
Plains
can someone help me pls im at a bubble in level one
4 0
Mommy chowmander21
07/14/2017 7:53 AM
The Lich Yard
um... hi
1 0
Alaya Dragitzu
07/14/2017 7:21 AM
Tower of Fate: Entrance (Plague)
2 0
MooTooKong Maxinut69
07/13/2017 11:10 PM
The Lich Yard
eDgE LOrD
3 0
Zane AQuietBanana
07/13/2017 8:29 PM
Iron Whale (Plague)
1 0
ssundee rakoop
07/13/2017 8:15 PM
Clockwork Tower (Plague)
just the tinkerer
0 0
Airao Laozim
07/13/2017 7:48 PM
Explodatorium
oooo
1 0
Airao Laozim
07/13/2017 7:09 PM
The Lich Yard
rsr
0 0
ZedClick lynastuart
07/13/2017 6:11 PM
Plains
do ou want to be my friend?I am a teenager.(for the information)
1 0
Bev Harry0-0Potter
07/13/2017 12:56 PM
Pridemoor Keep
just started playing the game. my friend and i can't beat king knight. help!
0 0
Matt MattNJack
07/13/2017 9:42 AM
Tower of Fate: ???? (Plague)
warning do not use spin burst unless you have the staff of surging!
0 0
Matt MattNJack
07/13/2017 9:33 AM
Tower of Fate: Ascent (Plague)
big booms destroy everyone!!!
0 0
Matt MattNJack
07/13/2017 9:25 AM
Tower of Fate: Ascent (Plague)
i cant believe i made it...
1 0
marcus alohamarcus
07/13/2017 8:03 AM
Iron Whale
trust me evan I`m getting beaten up from fricken iron whale I know how it feels
0 0
Seamus seamus215
07/13/2017 6:30 AM
The Lich Yard (Specter)
dang ghosht
2 0
XxDABBINxX Swipe06
07/12/2017 8:33 PM
Clockwork Tower
if you have the charge attack just jump and hit em when its charged if you have that attack
0 0
XxDABBINxX Swipe06
07/12/2017 8:12 PM
Armor Outpost
just buying amour
0 0
ALEX ALEXMONSTER25
07/12/2017 7:05 PM
Tower of Fate (Specter)
almost done with the game guys
1 0
Chloe wolfslick
07/12/2017 5:06 PM
Plains
First boss... All in all, good game!
2 0
Jack firetiger8.3.2
07/12/2017 4:48 PM
Tower of Fate (Specter)
Specter mode activate! Assemble all knights to resume true form!
2 0
snake ax.cie
07/12/2017 3:11 PM
Tower of Fate: Entrance
Am almost done with shovle kight 2 more quest left
0 0
mason tsenswampy12
07/12/2017 11:49 AM
Explodatorium (Specter)
wow
0 0
mason tsenswampy12
07/12/2017 11:25 AM
Tower of Fate (Specter)
wow one more hit and i would have died
4 0
WAT?!? justinq33
07/12/2017 6:47 AM
Plains (Specter)
Now i can play as the boss that took me forever to beat!
2 0
mason tsenswampy12
07/11/2017 6:50 PM
Armor Outpost
what!?!?! hat guy is bad!?!?
0 0
iann nintedoiscool327
07/11/2017 4:04 PM
Frigid Flight
I have bested Shovel Knight for a second time!
2 0
Sleeping NEPECATLEIJON
07/11/2017 2:58 PM
Tower of Fate: Entrance (Specter)
why cant Specter Knight swim
2 0
sans pizzaplayer369
07/11/2017 2:26 PM
Lost City
doing a collab play
1 0
joshyua joshy527
07/11/2017 1:30 PM
Plains
just got dis game so excited!!!
4 0
linkgamer jaynoahh
07/11/2017 12:44 PM
Explodatorium
2 0
Reality RealityJake
07/11/2017 10:31 AM
Plains
p1:Knows How to play p2: Just starts to play
1 0
Gameknight gameknight1000
07/11/2017 10:03 AM
Clockwork Tower (Specter)
Never underestimate a mechanic. This little tinkerer put up a pretty fierce fight.
1 0
Oneiodin Odizzle2093
07/10/2017 11:42 PM
Village (Plague)
apple juice any one need apple juice
3 0
Matt MatthewDread
07/10/2017 10:42 PM
Stranded Ship (Plague)
hi
0 0
Juz juz600
07/10/2017 8:02 PM
Plains (Specter)
I never thought i'd be able to play as Specter Knight!
3 0
Gameknight gameknight1000
07/10/2017 6:58 PM
Stranded Ship (Specter)
I have no clue what to do
0 0
Chicken papacasa
07/10/2017 6:37 PM
Lost City (Specter)
going green. literally
0 0
Dylan pixelkingdylan
07/10/2017 6:20 PM
Plains
The second dragon is impossible!
3 0
mason tsenswampy12
07/10/2017 4:55 PM
Explodatorium
easy!
0 0
Ryan BS_Alliance
07/10/2017 3:48 PM
The Lich Yard
kingll DJJgëœæ
1 0
lizzie grammarrodeo
07/10/2017 3:28 PM
Knuckler's Quarry
abcdefghijklmnopqrstuvwxyz
1 0
Ryan BS_Alliance
07/10/2017 3:27 PM
The Lich Yard
3 0
Ryan BS_Alliance
07/10/2017 3:03 PM
Village
who played specter of torment i did
4 0
Ryan BS_Alliance
07/10/2017 2:32 PM
The Lich Yard (Specter)
im in danger
0 0
jude judeCB
07/10/2017 1:07 PM
The Lich Yard (Plague)
SPECTER KNIGHT IS POWERFUL, SO I EXPECT NOTHING LESS THAN A CHALLENGE #SPECTERKNIGHTISFAVORITE
0 0
connor thelostminer626
07/10/2017 8:04 AM
Lost City
i cant wait for friday
1 0
gbill gbillinger123
07/10/2017 8:01 AM
Tower of Fate (Specter)
Oi ,oi`m the hedge farmer . you think yer edgey , oi`ll be the judge of that oi will. ok yer edgey
2 0
Zane AQuietBanana
07/10/2017 7:44 AM
Pridemoor Keep (Plague)
This part is so hard I swear
1 0
Toon Link ourdadrules557
07/10/2017 7:34 AM
Tower of Fate (Specter)
I've got gold for days
1 0
gbill gbillinger123
07/10/2017 6:33 AM
The Lich Yard
who thought the hall of champions was a boss rush and who played the whole game co-op
1 0
gbill gbillinger123
07/10/2017 6:27 AM
The Lich Yard
Someone should beat the game with this cheat trgsvppw put it on some paper its makes u 4x bigger .
0 0
michael cosmosity
07/10/2017 6:17 AM
Tower of Fate (Specter)
apples
1 0
Zane AQuietBanana
07/09/2017 9:45 PM
The Lich Yard (Plague)
1 0
aaaaaqqwwe holden119
07/09/2017 7:33 PM
Tower of Fate (Specter)
1 0
Heisenberg Heisenberg3556
07/09/2017 5:06 PM
Plains
I am savage
2 0
isaac isaaccharles
07/09/2017 5:01 PM
Plains
i died 10 times
7 0
C4 CurrentManCave
07/09/2017 4:31 PM
Stranded Ship
this game is the best
3 0
luca LucaO45
07/09/2017 4:23 PM
Forest of Phasing
this is so fun
0 0
fire skull tudor09
07/09/2017 3:20 PM
Plains
how do you get loot from a checkpoint
7 0
JoJo JonathanJoestar0
07/09/2017 3:09 PM
Campiña
4 0
Ryan BS_Alliance
07/09/2017 2:20 PM
Tower of Fate (Specter)
1 0
Ryan BS_Alliance
07/09/2017 2:18 PM
Tower of Fate (Specter)
0 0
Ryan BS_Alliance
07/09/2017 2:14 PM
Tower of Fate (Specter)
GO PLAY UNDERTALE
4 3
Ryan BS_Alliance
07/09/2017 2:12 PM
Tower of Fate (Specter)
am i from marvel or shovel knight
1 0
Ryan BS_Alliance
07/09/2017 2:08 PM
Tower of Fate (Specter)
IM serious
0 0
Ryan BS_Alliance
07/09/2017 2:05 PM
Tower of Fate (Specter)
IM SO FANCY,YOU ALREADY KNOW IT
2 0
Ady adylpika
07/09/2017 12:09 PM
Clockwork Tower (Specter)
2 0
Amelia DaisyAmooglie
07/09/2017 8:01 AM
The Lich Yard
I love this game it is so cool I could play it all day
1 0
TJ happyjack723
07/09/2017 7:43 AM
Explodatorium
Its soooo darn hard!!!! I'm a 92 year old tring to play this game
3 0
Yo Rickhart
07/09/2017 7:21 AM
Campiña
Aquí va, segunda vuelta seguida con este jefucho. Veamos quién es el maestro de la pala.
0 0
Yo Rickhart
07/09/2017 7:08 AM
Campiña
2 0
Thomas reliefpizza14
07/09/2017 5:31 AM
Pridemoor Keep
dead
2 0
Lil Blair lilblair1
07/08/2017 10:42 PM
Plains
coo
2 0
Weeaboo TheSnivyGuy1
07/08/2017 7:52 PM
Village
Hello fellow knights!
0 0
Matt MattNJack
07/08/2017 5:36 PM
Tower of Fate: Ascent (Plague)
cant believe i made it with no cheats!
0 0
Matt MattNJack
07/08/2017 5:24 PM
Tower of Fate: Entrance (Plague)
try lob casing component powder and remote fuse
0 0
jeremiah 123456JDW
07/08/2017 2:37 PM
Tower of Fate (Specter)
0 0
Clebbles SwagMuffin136
07/08/2017 2:11 PM
Pridemoor Keep
I am Groot.
5 0
Trainium d3adly_p0tat0es
07/08/2017 1:41 PM
Pridemoor Keep (Specter)
Two hours of skimming the level for the last skull for this?!
0 0
Sam AncientBambi
07/08/2017 12:55 PM
The Lich Yard
2 0
Ryan BS_Alliance
07/08/2017 12:41 PM
Tower of Fate (Specter)
My Secret:IM GANDOLF
1 0
Ryan BS_Alliance
07/08/2017 12:40 PM
Tower of Fate (Specter)
WHERE'S MY SHOVEL, AND MY BLUE HORN ARMOR?!!?
0 0
Ryan BS_Alliance
07/08/2017 12:38 PM
Tower of Fate (Specter)
give me pizza
0 0
Ryan BS_Alliance
07/08/2017 12:37 PM
Tower of Fate (Specter)
I HATE MY LIFE!!!!!
0 0
Ryan BS_Alliance
07/08/2017 12:36 PM
Tower of Fate (Specter)
0 0
Ryan BS_Alliance
07/08/2017 12:35 PM
Tower of Fate (Specter)
1 0
Ryan BS_Alliance
07/08/2017 12:33 PM
Tower of Fate (Specter)
u all smell (besides the prankster gangsters)
0 0
Bangerman Banjerman
07/08/2017 9:57 AM
Plains (Plague)
hi
1 0
5clovers fiveclovers
07/08/2017 8:57 AM
Pridemoor Keep
?
4 0
samuel wiiu101g
07/08/2017 8:57 AM
Tower of Fate (Specter)
lol this mode is so easy
5 0
AlexParker bmcall3168
07/08/2017 6:36 AM
Stranded Ship
how do you get past that stinkin spot
0 0
Matt MattNJack
07/07/2017 7:39 PM
Flying Machine (Plague)
cant stand this stupid f-ing airship!!!!
0 0
supersloth casebailey
07/07/2017 7:01 PM
Plains
hola
0 0
Geosh Pfroman
07/07/2017 5:59 PM
Plains
3 0
samuel wiiu101g
07/07/2017 4:07 PM
Explodatorium (Specter)
omg so annying level
0 0
M.T.E THE_LEON_CLAN
07/07/2017 2:51 PM
Stranded Ship (Specter)
i hate polar knight
3 0
symboto topmilk
07/07/2017 2:46 PM
Plains (Plague)
hello
1 0
M.T.E THE_LEON_CLAN
07/07/2017 1:38 PM
Tower of Fate (Specter)
treasure knight and king knight down, polar knight next
1 0
samuel wiiu101g
07/07/2017 12:43 PM
Tower of Fate (Specter)
the big fish from the ironwhale is annoying
5 0
Abers DrakeAbers
07/07/2017 12:06 PM
Stranded Ship (Specter)
red is his least favorite color
0 0
Q nallfamily
07/07/2017 11:11 AM
Pridemoor Keep (Specter)
this is hard on new game+
1 0
jeremiah 123456JDW
07/07/2017 8:38 AM
Clockwork Tower (Specter)
wwweeeeeee
0 0
goo gooberny
07/06/2017 8:48 PM
Armor Outpost
2017 shovel knight!
1 0
Korben lolloz7
07/06/2017 8:19 AM
Explodatorium
Plague Knight beaten on my 4th try
1 0
Evan mudkip982
07/06/2017 4:38 AM
Iron Whale
I keep dying from this stupid son of a @$#%* fish! >:(
1 0
Evan mudkip982
07/06/2017 4:21 AM
Explodatorium
Made it to plegue knight proboably gonna die for the 500th time now... |:(
1 0
BlazingTRS BrunoN25
07/05/2017 9:40 PM
Armor Outpost (Plague)
lel one of me rivals
0 0
BlazingTRS BrunoN25
07/05/2017 9:34 PM
Lost City (Plague)
LOL super easy first try trust me
0 0
BlazingTRS BrunoN25
07/05/2017 9:21 PM
Lost City (Plague)
lol i died
0 0
Gabe bunnycruz2014
07/05/2017 4:16 PM
Armor Outpost
I got the every single armor in one day!
4 0
matthew mharper94
07/05/2017 1:57 PM
Plains
defeated first boss
2 0
Gabe bunnycruz2014
07/05/2017 12:47 PM
Troupple Pond
what's under the surface
3 0
shane firebrand0013
07/05/2017 12:47 PM
Plains (Specter)
why me
3 0
John cheyisourcat
07/05/2017 12:06 PM
Tower of Fate (Specter)
1 0
Bene hailandfarewell
07/05/2017 11:48 AM
Explodatorium (Plague)
the exploritorium sucks!!!
2 0
Landon wcmerida
07/05/2017 9:24 AM
Plains
a diary.... this is embarrassing.......
5 0
nolan stamp401
07/05/2017 8:51 AM
Lost City
0 0
Zeke gggggg4
07/05/2017 8:33 AM
Tower of Fate (Specter)
1 0
Griffin 0LividPanda0
07/05/2017 6:01 AM
Plains
marshal plays Xbox
1 0
Griffin 0LividPanda0
07/05/2017 5:57 AM
Plains
ryhdsrthjferhhredbogdhgsngsvtsvhk@lnfsvjhfsqbvafwhcbyfvcchtsyggfgnv rgiijklofgkfpdjd@jfjflvfmfpf
1 0
Alice Dzwiice
07/04/2017 6:57 PM
Stranded Ship
this level is sooo hard! but im gonna get through it!!
1 0
Brett BrettSteele
07/04/2017 6:52 PM
Troupple Pond
1 0
Eu-sou-BR! bezorim3
07/04/2017 6:09 PM
Vilarejo
0 0
Eu-sou-BR! bezorim3
07/04/2017 6:03 PM
O Jardim do Espectro
dificil pakas!
0 0
Alexander Sharkkid711
07/04/2017 4:43 PM
Stranded Ship (Specter)
0 0
Alexander Sharkkid711
07/04/2017 4:28 PM
Stranded Ship (Specter)
1 0
pavle pavle3
07/04/2017 4:02 PM
Pridemoor Keep
2 0
Alexander Sharkkid711
07/04/2017 3:57 PM
Tower of Fate (Specter)
specter knight is sick but mostly cool
3 0
hap pyy buttclarf
07/04/2017 3:19 PM
Plains
im so bad that i cant defeat black knight
1 1
Bryan Brydawg29
07/04/2017 12:59 PM
Flying Machine (Specter)
I do love the sunset in the background=}
0 0
Bryan Brydawg29
07/04/2017 12:46 PM
Tower of Fate (Specter)
i like tacos
6 0
Bryan Brydawg29
07/04/2017 12:43 PM
Tower of Fate (Specter)
1 0
BlazingTRS BrunoN25
07/04/2017 9:52 AM
Tower of Fate (Specter)
hoi
1 0
Bryan Brydawg29
07/03/2017 10:55 PM
Tower of Fate (Specter)
ITS BEEN A MILLION YEARS AND I DID IT : ) :) :-)
1 0
??? kirbykid2
07/03/2017 9:06 PM
The Lich Yard (Plague)
no
1 0
Zachary sargeeq
07/03/2017 7:18 PM
Tower of Fate: ???? (Specter)
ok i'm going to admit. The true final boss has a very cool concept. Rail grinding to attack the kid.
4 0
Nas Luigiguy64
07/03/2017 7:15 PM
Tower of Fate (Specter)
UGH, FINALLY!!! The upgraded chronos coin was a HUGE help!
0 0
Zachary sargeeq
07/03/2017 7:14 PM
Tower of Fate: ???? (Specter)
FINALLY, I AM DONE WITH THE THIS- (True final boss shows up) OH SON OF A WH0RE
3 0
josiah shadowxen
07/03/2017 4:57 PM
Village (Plague)
0 0
Josh opflash2
07/03/2017 4:22 PM
The Lich Yard
4 0
Zachary sargeeq
07/03/2017 3:52 PM
The Lich Yard (Specter)
WHY HATH LIFE FORSAKEN ME?!
2 0
taterboy72 southsidemyke
07/03/2017 3:39 PM
The Lich Yard
This game be fun
0 0
Plague <:= vitri0l
07/03/2017 2:22 PM
Explodatorium (Specter)
IM SO SORRY PLAGUE KNIGHT
2 0
Plague <:= vitri0l
07/03/2017 2:19 PM
Explodatorium (Specter)
Crows op plz nerf
3 0
Plague <:= vitri0l
07/03/2017 2:17 PM
Explodatorium (Specter)
Time to go kill my last and favorite knight of all time...
1 0
Luis07 Luis-Enrique-07
07/03/2017 1:25 PM
Explotatorium (Specter)
excelente campaña
0 0
Gking10 GaryRo
07/03/2017 12:05 PM
The Lich Yard (Plague)
I haven't played in a long time, and I forgot how to use my burst. HELP!!
1 0
Mr. Flapjk Boismenu
07/03/2017 10:58 AM
Pridemoor Keep (Specter)
Man, the Pridemoor Keep song is good!
0 0
isaac omgods
07/03/2017 10:00 AM
Knuckler's Quarry
repeatedly use dust knuckles to get through.
1 0
SteveDiego l-loffman
07/03/2017 8:28 AM
Finca de Liches
este juego es increible y dificil
0 0
SteveDiego l-loffman
07/03/2017 8:24 AM
Finca de Liches
es un poco dificil
0 0
Zachary sargeeq
07/03/2017 8:20 AM
Explodatorium (Plague)
I AM THE VERY POWERFUL!
0 0
UpЖStreаm ms.baddinyan
07/03/2017 7:39 AM
Clockwork Tower (Plague)
This boss is easy with the no weopon cooldown cheat
0 0
Guero KodaYasha
07/02/2017 6:49 PM
Plains
Just started playing the game. Still getting use to the control lol
1 0
treymac1 polkmzasfnbtj
07/02/2017 5:49 PM
Plains (Specter)
wow have not played in a while
2 0
jimbo jtelwhiting
07/02/2017 1:47 PM
Plains (Plague)
3 0
William WillyD3
07/02/2017 1:19 PM
Explodatorium
its shovel slime!
0 0
Noah ArcherKirby789
07/02/2017 1:17 PM
The Lich Yard (Specter)
Specter of torment has to be the best campaign so far. Can't wait for King knights!
1 0
Will KalirSavant
07/02/2017 1:15 PM
Tower of Fate: Ascent
Writing a full diary post in free fall? That's easy. The hard part's at the end.
1 0
William WillyD3
07/02/2017 1:06 PM
The Lich Yard
lol i used a cheat
1 0
BTL55 BTL_55
07/02/2017 1:03 PM
Village
This game is really fun
1 0
jr joshuabell
07/02/2017 12:28 PM
Plains (Plague)
How do I get the block above me!!!!!!!!!!!
1 0
thiago nomazanj
07/02/2017 12:25 PM
Máquina Voladora
complee una sala xd
0 0
William WillyD3
07/02/2017 12:19 PM
Tower of Fate: ????
THE ENTANTRESS IS SHIELD KNIGHT
5 1
thiago nomazanj
07/02/2017 12:15 PM
Máquina Voladora
la nave esta
0 0
Fito riichieeAG
07/02/2017 11:34 AM
Explotatorium
Atoralo en sus pociones, no tendras mas opciones
1 0
Quimarda Quimarda
07/02/2017 10:44 AM
Ballena de Hierro
lol difícil
0 0
Bill Matthew2309
07/02/2017 10:24 AM
Village
oh no
4 0
UpЖStreаm ms.baddinyan
07/02/2017 9:14 AM
Tower of Fate: Ascent
When you make every one a girl but you stay as a dude
2 0
UpЖStreаm ms.baddinyan
07/02/2017 8:54 AM
Flying Machine
Propeller Knight (♀) has a nice rack _/(ºuº)/`
1 0
UpЖStreаm ms.baddinyan
07/02/2017 8:37 AM
Clockwork Tower
Not even god mode can save you
0 0
UpЖStreаm ms.baddinyan
07/02/2017 8:34 AM
Clockwork Tower
Having god mode helps in this stage
0 0
UpЖStreаm ms.baddinyan
07/02/2017 8:30 AM
Stranded Ship
The propeller dagger helps here
0 0
vincent vince-n-gianna
07/02/2017 7:11 AM
The Lich Yard
dum
4 0
gbill gbillinger123
07/02/2017 6:12 AM
Tower of Fate (Specter)
2 0
arthur leosilmendes
07/01/2017 6:28 PM
Pridemoor Keep
0 0
Clone5885 megaeu5
07/01/2017 6:18 PM
Anteposto de armaduras
Como eu uso a habilidade Abre-Valas?
0 0
Nate jupiter7474
07/01/2017 5:50 PM
Lost City
Ha you thought it had spoilers?! Get PRANKED! ITS JUST A PRANK BRO!
3 0
Nas Luigiguy64
07/01/2017 5:44 PM
Beeto's Big Break
And THIS, is why Shovel Knight Maker will never exist.
5 0
Monnie SkullKid3D2
07/01/2017 4:33 PM
The Lich Yard (Specter)
very shocking turn of events
0 0
dunzo marioman98
07/01/2017 1:26 PM
Plains
ba
0 0
katherine cosmocosmo
07/01/2017 10:27 AM
Plains
3 0
gummy me64 CyclonicDuke
07/01/2017 9:49 AM
Clockwork Tower (Specter)
2 0
julio link7700
06/30/2017 9:47 PM
Torre del Hado (Specter)
pobre de la armadura nadie la visita T~T
1 0
X xjgarcia
06/30/2017 9:15 PM
Plains
The truth is that black knight is ecatly shield knights brother%)
3 0
thiago nomazanj
06/30/2017 8:00 PM
Torre del Hado (Specter)
1 0
Night Owl krblkb222
06/30/2017 5:36 PM
Stranded Ship
I can't believe I FINALLY cleared that room! WOOHOO!!!!!
1 0
maddox sanchez804
06/30/2017 3:57 PM
Tower of Fate: Entrance
HELLOOOO
2 0
maddox sanchez804
06/30/2017 3:55 PM
Plains (Plague)
2 0
katherine cosmocosmo
06/30/2017 3:42 PM
Plains (Specter)
3 0
HipstaDeer BuilderOfStuff
06/30/2017 3:04 PM
Flying Machine
3 0
Eduardoccc eduardoccc
06/30/2017 2:48 PM
Vilarejo
dafdnhm
0 0
Eduardoccc eduardoccc
06/30/2017 2:31 PM
Planícies
efdesde
0 0
Eduardoccc eduardoccc
06/30/2017 2:28 PM
Planícies
ewsd
0 0
Eduardoccc eduardoccc
06/30/2017 2:28 PM
Planícies
eduardo
0 0
AlexParker bmcall3168
06/30/2017 1:14 PM
Explodatorium (Plague)
you guys are fired!!!!!!!!
2 0
Sleeping NEPECATLEIJON
06/30/2017 12:24 PM
Tower of Fate (Specter)
1 0
Mark kirbyfat54321
06/30/2017 11:59 AM
Flying Machine (Plague)
0 0
sans jackey05
06/30/2017 11:14 AM
The Lich Yard (Plague)
1 0
Brenden brenmac8
06/30/2017 9:59 AM
Tower of Fate (Specter)
so i just found out.... THE ONLY THING U GET FROM THIS IS 2K GOLD
2 0
Brenden brenmac8
06/30/2017 9:28 AM
Clockwork Tower (Specter)
just use the barrier lantern and stand on rocket shoulder of part 2 and chronos coin for part 1
1 0
derpgrad83 MYSCHIEF
06/30/2017 9:04 AM
Iron Whale
On the Iron Whale, great music!
3 1
LorD_StUkA MR_STUKA
06/30/2017 8:45 AM
Máquina Voladora
este juego es increibe !!
0 0
Eduardoccc eduardoccc
06/30/2017 4:51 AM
Fortaleza de Brejorgulho (Plague)
eduardo
0 0
Awesome.jr awesomebry21
06/30/2017 12:38 AM
Tower of Fate: Entrance (Specter)
why...
0 0
jp JP-Bookworm
06/29/2017 7:30 PM
Village
Anybody have any tips on how to beat specter knight
1 1
greysen greysendrake
06/29/2017 7:17 PM
The Lich Yard
2 0
Jacob jacob112306
06/29/2017 4:51 PM
Pridemoor Keep
4 0
Sven mr.sven.online
06/29/2017 3:35 PM
Flying Machine (Specter)
6 0
Elijah coolioe12
06/29/2017 3:05 PM
Clockwork Tower
i keep dying in tinker knits place
1 0
Jordan Manfam2014
06/29/2017 2:50 PM
Flying Machine
0 0
noah rfdino
06/29/2017 2:26 PM
Plains
"STEEL THY BUTT" - Shovel Knight
3 1
la p pedrofabian1
06/29/2017 2:02 PM
Plains
4 0
Eric ericsosa723
06/29/2017 1:06 PM
Plains
Triple bubbles
0 0
Evan Beeshroom
06/29/2017 12:24 PM
Plains (Plague)
Blast jump is SSSSOOOOO hard to use!
2 1
guy! bowfixed101
06/29/2017 9:02 AM
Village (Plague)
what do i do in the village
2 2
gbill gbillinger123
06/29/2017 6:18 AM
Village
How many people used the ichor that draws money to you?
1 0
gbill gbillinger123
06/29/2017 6:14 AM
Village
Who played the whole game co-op? I did .
2 0
Noah Noahjd2000
06/29/2017 3:24 AM
Explodatorium
i dont know bytvgowgjjjgddggjjjkkglk'kpk
2 0
Lynkono Lynkono
06/28/2017 6:00 PM
Tick Tock Tower
Though you can't swing your shovel, hold down in mid-air under enemies.
0 0
#ThugLife★ KWRC_GAMER
06/28/2017 5:44 PM
Explodatorium
So goooooooooooooooood!!!!! XD GG
1 0
Evan Beeshroom
06/28/2017 12:49 PM
Pridemoor Keep
As I beat King Knight, he used his confetti move. It looked like I was congratulated for winning!
1 0
Evan Beeshroom
06/28/2017 11:54 AM
Plains
Is it just me, or is level 1 impossible
1 0
Red lightningcannon
06/27/2017 8:10 PM
Tower of Fate: Entrance (Specter)
On my way to the end.
6 0
sonicfan13 sonicfan0303
06/27/2017 6:42 PM
Plains
Impossible
2 0
lucas :) doctor_lucas
06/27/2017 5:36 PM
Pridemoor Keep (Plague)
i have cheats boooiiii
3 0
Novo Novolww
06/27/2017 4:45 PM
Encuentro - Baz
gg easy Baz
0 0
Ghost legolord5000
06/27/2017 3:27 PM
Explodatorium
this is so hard
0 0
matt mjs717
06/27/2017 3:00 PM
Plains (Plague)
1 0
isaiah jennykate77
06/27/2017 2:16 PM
Plains
2 0
T-Dex pletcher4
06/27/2017 2:02 PM
Tower of Fate (Specter)
yeet
4 0
Thomas snakethegreat
06/27/2017 1:53 PM
Clockwork Tower
Clockwork tower is the best track in the game...
1 0
CrazyJeff CrazyJeff
06/27/2017 11:23 AM
Tower of Fate (Specter)
Specter Knight is completely amazing!
6 0
nico realistcchip9
06/27/2017 8:44 AM
Explodatorium
this is the hardest level in the world
1 0
gbill gbillinger123
06/27/2017 7:29 AM
Stranded Ship (Specter)
Shovel /specter/plague knight level maker. We need it now
0 0
Xavier B. XTB-gamer04
06/27/2017 7:18 AM
Flying Machine
I HATE THE GREEN GUYS THAT BLOW YOU AROUND!!!! Great game though!
2 0
gbill gbillinger123
06/27/2017 7:15 AM
Tower of Fate (Specter)
9 0
gbill gbillinger123
06/27/2017 7:12 AM
Tower of Fate (Specter)
Wheres my troupple king post avatar game?
3 0
James cisnito
06/27/2017 5:42 AM
Troupple Pond (Plague)
Has anyone else gotten "Romance Advice" from "Sir Percival"?
4 0
Brandon Poobsack
06/26/2017 10:42 PM
Tower of Fate: Entrance
hello
1 0
DracoChamp Jamisdraco
06/26/2017 8:47 PM
Clockwork Tower (Specter)
Wow, I did not know that you could post to miiverse in Shovel Knight™ now. That is pretty cool.
0 0
BKPlayz bknyGaming
06/26/2017 6:35 PM
Plains
Why can't I jump on the last part!!!!???
1 0
Mac macc888
06/26/2017 6:17 PM
Pridemoor Keep
poop gaym
3 0
Brandon bretzb95
06/26/2017 5:38 PM
Clockwork Tower
It's Time to Write out your will and get your gravestone.
0 0
thiago nomazanj
06/26/2017 5:27 PM
Finca de Liches
izi bro
0 0
AlexParker bmcall3168
06/26/2017 12:21 PM
Tower of Fate: ???? (Specter)
stupid evil blocks
4 0
Nick AlbinoLucario
06/26/2017 10:55 AM
Village (Plague)
Meesa usin da code PL&JRJR.
1 0
*** stinkfly
06/26/2017 10:47 AM
Rematch: Nightmare Reize
I don't need wings for I am god
1 0
Zack zack700
06/26/2017 9:45 AM
The Lich Yard (Plague)
0 0
Sans Teentitansgo2005
06/26/2017 8:28 AM
Hall of Champions
Mabye you fight a Nintendo character/Charcters
0 0
Sans Teentitansgo2005
06/26/2017 8:26 AM
Hall of Champions
Its just like X-Box and Ps4.Theres that room in the same place.Mabye theres a way in.
0 0
Sans Teentitansgo2005
06/26/2017 8:25 AM
Hall of Champions
Do you see the the carpet/room in the bottom corner?Could this be the seconed DoUbLe SeCrEt?
0 0
josh fluffybabywa
06/26/2017 7:08 AM
Tower of Fate (Specter)
<--That guy is so hard to beat!!!
1 0
Daniel DanielMcnugget12
06/26/2017 12:48 AM
Clockwork Tower
you can use the mobile gear to instakill tinker knight in his first phase
3 0
Jake okapi162
06/25/2017 8:34 PM
Tower of Fate: Entrance (Specter)
this level is gonna give me a brain aneurysm
2 0
Zach ZachSwarts
06/25/2017 5:37 PM
The Lich Yard (Specter)
this is like impossible if the zombies die in one hit it will be easy like very easy-peasy - lemon
0 0
AlexParker bmcall3168
06/25/2017 5:20 PM
Tower of Fate: Entrance (Specter)
a hate this the LEVEL. IT IS IMPOSSIBLE TO BEAT THIS LEVEL!!!!!!!!!!!
2 0
Jimmy Trollz117
06/25/2017 4:08 PM
The Lich Yard (Specter)
5 1
Austin Link.MLG
06/25/2017 3:56 PM
Tower of Fate (Specter)
Did anyone know that you can pet the cat with the Cold Sholder?
7 0
jt coolkingjt
06/25/2017 3:25 PM
Hall of Champions
defeated the hall of champions on a solo run with no cheats
0 0
maddox sanchez804
06/25/2017 2:19 PM
Pridemoor Keep
True :c
0 0
Mycah SkylanderMyke
06/25/2017 2:05 PM
The Lich Yard
this next part is hell
2 0
Mycah SkylanderMyke
06/25/2017 1:35 PM
The Lich Yard
sooooo hard csnt beat spec
1 0
Lucavi Legend-of-Lucavi
06/25/2017 11:38 AM
Plains (Specter)
6 0
Sir Potato SirPotatop
06/25/2017 11:01 AM
Torre Mecánica
0 0
Elijah coolioe12
06/25/2017 8:21 AM
Iron Whale
why game so harsh
3 1
Victor LoganK252
06/25/2017 6:30 AM
Plains
I will defeat the Black Knight and burn him!
3 0
Twist3n Trist3ndud3
06/25/2017 4:48 AM
The Lich Yard
cracking open a cold one with the boys
2 0
jon jon jonjaygonz
06/24/2017 9:33 PM
Plains
yea boi i am a n00b!
0 0
Tiffany lilleli36
06/24/2017 9:10 PM
The Lich Yard
thanks for the tip
3 0
ky0x kenwakyo
06/24/2017 7:34 PM
Pridemoor Keep
wowwwww
0 0
AlexParker bmcall3168
06/24/2017 1:21 PM
Tower of Fate: Entrance (Specter)
do any of you guys think that black night is luan
5 0
Annika CoffieCrisp
06/24/2017 11:34 AM
The Lich Yard (Specter)
The Lich Yard is hard.
3 0
Annika CoffieCrisp
06/24/2017 10:36 AM
Tower of Fate (Specter)
Am I not cute? #missyiscute #ismissyspecterknightsgirlfriend #spectyisawesome
4 0
Annika CoffieCrisp
06/24/2017 10:29 AM
Tower of Fate (Specter)
Specter Knight, Specter Knight. Specter Knight is the new SpiderMan. With a Syth other then webbing.
2 0
Annika CoffieCrisp
06/24/2017 10:27 AM
Tower of Fate (Specter)
Specter Knight must have a busy life. Expetaly in his past as Donovan. Poor guy must hate his life.
3 0
Annika CoffieCrisp
06/24/2017 10:24 AM
Tower of Fate (Specter)
Spoiler Alert!: Specty's locket is actually the phase locket Shovel Knight finds in the Lich Yard!!!
2 0
Annika CoffieCrisp
06/24/2017 10:20 AM
Tower of Fate (Specter)
How do you unlock the gal who gives you the "kiss of death"? And does Specty have a girl friend? :/
0 0
Annika CoffieCrisp
06/24/2017 10:15 AM
Tower of Fate (Specter)
What is in the locket? Is it my heart or my life? Either way, I want to know.
0 0
Annika CoffieCrisp
06/24/2017 8:57 AM
Plains (Specter)
Boy, Black Knight is weak. That was easy. #firstblackknightbattle
2 0
Annika CoffieCrisp
06/24/2017 8:51 AM
Plains (Specter)
WHY DO I KEEP DIEING!
1 0
Ryan Ryan5445
06/24/2017 7:45 AM
Tower of Fate (Specter)
whats the point in having coins?
1 0
Annika CoffieCrisp
06/24/2017 7:40 AM
Pridemoor Keep
I AM A GIRL! SHOVEL KNIGHT'S A GIRL EVERYBODY! #bodyswapmode
1 0
Santi Santi_super_10
06/24/2017 7:31 AM
Explodatorium
4 0
Baby Reyes Little_Rey
06/24/2017 6:44 AM
Plains
1 0
jeraniel phanny09
06/23/2017 8:38 PM
Plains (Specter)
gay
2 0
snakles yt bobmcflob
06/23/2017 4:15 PM
Plains (Specter)
eyyy waddup
4 0
Star_Cute Starly_Punch
06/23/2017 3:22 PM
Fortaleza del Orgullo
My first Shovel Knight level: Completed!
0 0
Luke beeboy123
06/23/2017 1:27 PM
Clockwork Tower (Specter)
Specter Knight is my favorite character
0 0
Jason Da_Ranger
06/23/2017 12:53 PM
Tower of Fate (Specter)
I got all red skulls!!!!
1 0
wiiston wiiston
06/23/2017 11:13 AM
Tower of Fate (Specter)
FIRST TRY :D
0 0
Isaac B3ars_Dad
06/23/2017 9:24 AM
Village
I am propeller knight
3 0
mini miniborg
06/23/2017 8:36 AM
Explodatorium
its so crazy here! bombs are every where!!
1 0
Sage SageTheEnder
06/22/2017 11:29 PM
Lost City (Specter)
Boss Time!
0 0
Sage SageTheEnder
06/22/2017 7:48 PM
Pridemoor Keep (Specter)
My favorite level, especially in Specter of Torment!
1 0
AlexParker bmcall3168
06/22/2017 5:44 PM
Tower of Fate (Specter)
were is the secret room?
0 0
AlexParker bmcall3168
06/22/2017 5:20 PM
Tower of Fate (Specter)
seirously whaen are they going to make king knight's campain
3 0
josiah shadowxen
06/22/2017 5:08 PM
Village
miedkkjfjorrrr
6 0
Mr.Alan SeniorSlender
06/22/2017 3:28 PM
Campiña
hello!!
0 0
General C DCamper200
06/22/2017 2:32 PM
Lost City (Specter)
WORST LEVEL IN SHOVEL KNIGHT. EVER.
1 0
Saki Streettyy
06/22/2017 2:30 PM
Pridemoor Keep
I meant king knight
2 0
Saki Streettyy
06/22/2017 2:29 PM
Pridemoor Keep
Shovel king is so easy
0 0
Saki Streettyy
06/22/2017 1:54 PM
Plains
This dragon is going to be my death
1 0
Dr kevin kevinandjp
06/22/2017 1:18 PM
Pridemoor Keep (Specter)
2 0
AlexParker bmcall3168
06/22/2017 11:43 AM
Tower of Fate (Specter)
why are so many levels hard ish
2 0
saiah boom5it
06/22/2017 7:48 AM
Village
got all the armor
3 0
radblaster scoobydoobydont
06/22/2017 12:02 AM
Clockwork Tower
i don't have a wii u.
0 0
Ethan Ethan_5972
06/21/2017 7:11 PM
Tower of Fate: Entrance (Plague)
EASY I USED normal case, spark, impact, and spin charge
0 0
KingJay03 kingjay03
06/21/2017 6:50 PM
Plains (Specter)
Whats a king without knights
0 0
proboss yfhdefhsgjffjhdg
06/21/2017 6:22 PM
Explodatorium
2 0
Henry GreenThunder909
06/21/2017 5:38 PM
Iron Whale (Specter)
What a difficult enemy! Lucky for us, he seems to be placed in a very unlucky spot...
5 0
Logan aaronnguyen
06/21/2017 5:37 PM
Plains
yeah
2 0
Henry GreenThunder909
06/21/2017 5:34 PM
Iron Whale (Specter)
Iron Whale? More like Iron Snail!
1 0
james jamesfwii
06/21/2017 2:48 PM
The Lich Yard (Specter)
I like remix
2 0
MEGASTORM FreyaCrescent118
06/21/2017 1:39 PM
The Lich Yard
0 0
Joey petersprince
06/21/2017 1:36 PM
Tower of Fate (Specter)
That tower game is SO HARD! I have a tip though! Buy the coin that slows down time, then upgrade it.
1 0
springtrap oldschool1213
06/21/2017 11:34 AM
Iron Whale
l hate anglerfish now...
6 0
michael DADARKNIGHT
06/21/2017 11:28 AM
Tower of Fate (Specter)
yo
1 0
Coll lucariomaster8
06/21/2017 10:51 AM
Hall of Champions (Plague)
All these faces look familiar...
0 0
saiah boom5it
06/21/2017 9:29 AM
Village
easy way to get money
8 1
saiah boom5it
06/21/2017 9:26 AM
Village
me and playing shovel night
1 0
Shakoor Shakoorwiiu
06/20/2017 6:57 PM
Plains (Plague)
You just got destroyed AGAIN on hard mode, Black Knight. Git Gud
1 0
Ethan Ethan_5972
06/20/2017 6:10 PM
Tower of Fate: ????
YOU MAY HAVE DEFEATED ME, SHOVEL KNIGHT, BUT I SHALL RETURN TO END YOU!! Sincerely, Tinker Knight
1 0
Ethan Ethan_5972
06/20/2017 6:05 PM
Tower of Fate: ????
Why are you reading this
0 0
max ariz3000
06/20/2017 4:45 PM
Tower of Fate (Specter)
are they gonna make a king knight update?
1 1
JSlim veganstyle
06/20/2017 2:33 PM
Plains (Specter)
omg i just startedand thisvis awesome
0 0
Erwin gamer821
06/20/2017 2:22 PM
Lost City (Specter)
hi
1 0
Star_Cute Starly_Punch
06/20/2017 1:07 PM
Campiña
Shovel knight rocks!!!
0 0
Big Daddy PuzzleFactory
06/20/2017 11:32 AM
Plains
1 0
*** stinkfly
06/20/2017 11:06 AM
Tower of Fate (Specter)
meh
1 4
Dude Dude1974
06/20/2017 11:01 AM
Plains (Plague)
0 0
braykas Braykas
06/20/2017 10:30 AM
Plains
hi
2 0
boo 2.0 Booace
06/20/2017 8:38 AM
Explodatorium (Specter)
in plague knights dungon
1 0
Joey petersprince
06/20/2017 8:30 AM
Tower of Fate: Entrance (Plague)
"cry" It's so sad... Its a love story. (Please no spoilers)
0 0
Ama AMA61281
06/19/2017 7:49 PM
Flying Machine (Specter)
hard but fun!!!
3 0
Kieran theonlykieran
06/19/2017 7:47 PM
Tower of Fate (Specter)
2 0
Ethan Ethan_5972
06/19/2017 7:21 PM
Tower of Fate: Ascent
AWKWARD
2 0
savage man Orrinsj
06/19/2017 4:44 PM
Plains
i win burn black knight!
1 0
Drewskie Drewskie117
06/19/2017 4:40 PM
Iron Whale
easy! just use invulnerability relic
2 0
savage man Orrinsj
06/19/2017 4:31 PM
Plains
yo
3 0
Isaac ZippyZappy306
06/19/2017 3:19 PM
Stranded Ship (Specter)
On the final swith, make sure to position yourself correctly
1 0
Isaac ZippyZappy306
06/19/2017 3:15 PM
Stranded Ship (Specter)
When he swoops down, you can also use the lanterns to avoid his attack
1 0
Ethan Star_Surf-1234
06/19/2017 12:48 PM
Plains (Plague)
1 0
Cooper SoniCoop
06/19/2017 8:56 AM
Lost City (Specter)
1 0
Awesome.jr awesomebry21
06/19/2017 8:43 AM
Tower of Fate: Entrance
i cant get past the first checkpoint
3 0
i-Way x2Days
06/19/2017 6:22 AM
Plains (Specter)
Hello and Welcome, ladies and gentlemen :)
1 0
B★R★Y★A★N bryanishired
06/19/2017 4:11 AM
Flying Machine (Plague)
Gosh dang it! This level is even WORSE as Plague Knight!
0 0
Jake SONICRULES2012
06/18/2017 7:39 PM
Pridemoor Keep
tryin that body swap thing
6 0
Logan aaronnguyen
06/18/2017 4:19 PM
Plains
YEAH
0 0
Logan aaronnguyen
06/18/2017 4:17 PM
Plains
really u dont
1 0
ALBARA drmalfares
06/18/2017 3:23 PM
Troupple Pond
2 0
ALBARA drmalfares
06/18/2017 3:07 PM
The Lich Yard
4 0
Jonathan Shinesprite
06/18/2017 2:35 PM
Tower of Fate (Specter)
If I forgot to talk to one of the Order of no Quarter in the tower, can still get the feat?
3 1
Jorge Georth30
06/18/2017 2:00 PM
Explodatorium (Specter)
Easy AF, actually kind of entertaining
0 0
THE MIDGET jacob121607
06/18/2017 1:28 PM
The Lich Yard (Plague)
I don't know but do you get to play as Shield Knight if you beat the game
0 1
Cooper SoniCoop
06/18/2017 1:22 PM
Plains (Specter)
So... anyone come on and find out you have two more games ????
2 0
yoshi barryyokoyama
06/18/2017 10:39 AM
Plains
I CAN'T GET PAST THE FIRST LEVEL! OMG!
1 1
THE MIDGET jacob121607
06/18/2017 8:45 AM
Lost City
whom do you like better Shovel Knight, Scepter Kight or Plauge Kinght
1 0
Sr.Lula.M pedrobruni
06/18/2017 8:25 AM
Vilarejo (Plague)
jooj
0 0
THE MIDGET jacob121607
06/18/2017 7:50 AM
Pridemoor Keep (Specter)
DUMB LAVA POTS
1 0
Edison Edison_Tse
06/18/2017 7:42 AM
Flying Machine
Defeated him in less than a minute!
1 0
Edison Edison_Tse
06/18/2017 7:33 AM
Flying Machine
Hi
0 0
Drew D Dalek06
06/18/2017 7:28 AM
Tower of Fate (Specter)
forget plauge night, now that was a chalenging rieze battle.
0 0
Edison Edison_Tse
06/18/2017 7:28 AM
Flying Machine
Hi
0 0
Edison Edison_Tse
06/18/2017 7:03 AM
Village
Spin ye bottle!
1 0
Kohen kkmac13
06/18/2017 6:46 AM
Tower of Fate: Ascent (Plague)
THIS IS SO HARD
2 0
Midna MojitoSunrise
06/18/2017 3:42 AM
Lost City (Specter)
0 0
Midna MojitoSunrise
06/18/2017 2:55 AM
Clockwork Tower (Specter)
0 0
Midna MojitoSunrise
06/18/2017 1:54 AM
Explodatorium (Specter)
0 0
Midna MojitoSunrise
06/18/2017 1:29 AM
Tower of Fate (Specter)
3 0
Midna MojitoSunrise
06/18/2017 1:27 AM
Pridemoor Keep (Specter)
0 0
Midna MojitoSunrise
06/18/2017 1:04 AM
Pridemoor Keep (Specter)
so hard
0 0
gbill gbillinger123
06/17/2017 8:40 PM
Village
how does the bard play the tinker knight theme and a whole bunch of other songs on a guitar #srsly
7 0
Benja Ben1986
06/17/2017 6:43 PM
Finca de Liches
ft
2 0
THE MIDGET jacob121607
06/17/2017 4:29 PM
The Lich Yard
the boss is so hard i wish i had someone to help me in co-op mode
3 0
Nomedtac Nomedtac
06/17/2017 2:36 PM
Plains (Specter)
Best game ever!!!
4 0
Gordo afteria
06/17/2017 2:20 PM
Plains
Try killing al three slimes without touching the ground! Its fun!d
1 0
Gordo afteria
06/17/2017 2:18 PM
Plains
Hard? I say fun!
1 0
Joe ottenfam2.0
06/17/2017 1:22 PM
Tower of Fate (Specter)
i am not gud
1 0
*** stinkfly
06/17/2017 11:43 AM
Village (Plague)
I'm an edge lord
0 0
Chris pyro666666
06/17/2017 11:19 AM
Plains (Plague)
cfgvf
4 0
uneven alvino32
06/17/2017 11:10 AM
Ballena de Hierro
easy bro
0 0
Envy SRIEG17
06/17/2017 9:26 AM
Fortaleza del Orgullo (Specter)
muere rey
0 0
FearFiend mario2337
06/16/2017 11:16 PM
The Lich Yard
eat my best butter
3 0
b brandon78724
06/16/2017 9:42 PM
The Lich Yard (Specter)
best
1 0
YukiSparkz YukiSparkz
06/16/2017 7:37 PM
Baleia de Ferro
Na moral, que fase chata, meu Deus
0 0
Billy4213 Billy4213
06/16/2017 6:27 PM
Tower of Fate (Specter)
I CAM IN LIKE A WREKEING BALL
0 0
Alien #37 wii_iz_fun
06/16/2017 6:14 PM
Flying Machine (Specter)
y is this better than playing shovel knitht??!?!?
1 0
Myself josiahs13
06/16/2017 4:46 PM
Troupple Pond
why is the dance so long????????????????????????????????????????????????????????????????????????????
7 0
H Quack5
06/16/2017 3:51 PM
Tower of Fate (Specter)
My sisters fish dead
4 0
Elijah coolioe12
06/16/2017 3:26 PM
Tower of Fate (Specter)
i got gud
1 0
Elijah coolioe12
06/16/2017 3:13 PM
Explodatorium (Specter)
no i died ps i hate resie
0 0
MASTA Stevegoron
06/16/2017 2:54 PM
Plains (Specter)
i hate this dumb game
1 1
FeAr_flame solache
06/16/2017 2:06 PM
Plains (Specter)
lol got this @ the library
0 0
nathan nathanfer
06/16/2017 12:42 PM
Plains
i rule the souls
4 0
Edna Mode freddyf1234
06/16/2017 12:02 PM
Plains
lol
1 0
Nulled CEnetwork
06/16/2017 11:09 AM
Village (Plague)
2 0
ZRC Z.R.C_u
06/16/2017 8:20 AM
Tower of Fate (Specter)
1 0
H Quack5
06/16/2017 6:12 AM
Village (Plague)
What if every knight you deafeated became a part of your team?
4 0
harryperry harry2166
06/16/2017 5:10 AM
Village
2 0
weirdnwild weirdnwild91
06/15/2017 9:46 PM
Pridemoor Keep
1 0
Wafflez Zeldastarwars
06/15/2017 6:58 PM
Plains
1 0
rock lee BobTheGreat772
06/15/2017 3:23 PM
Pridemoor Keep
0 0
Lil′☆Star☆ TwinStarsGalXSea
06/15/2017 2:37 PM
Village (Plague)
what can you do in plague ninets room?
2 2
mc mcpipz_taco
06/15/2017 8:47 AM
Tower of Fate (Specter)
FLYING RATS!!!!!!!.......ok
1 1
B★R★Y★A★N bryanishired
06/15/2017 8:32 AM
Clockwork Tower
2 0
lightghost Jsparrow6
06/14/2017 7:53 AM
Clockwork Tower
2 0
jude judeCB
06/14/2017 7:40 AM
Plains (Specter)
TERROSPIN IS A NICE STEED FOR BLACK KNIGHT.
5 0
Glen robotdude777
06/14/2017 5:21 AM
Armor Outpost
KING KNIGHT FOR LIFE
1 0
Glen robotdude777
06/14/2017 5:18 AM
Armor Outpost
boss man i havent heard of you
0 0
Ycles ycles10
06/13/2017 6:46 PM
Planícies
2 0
whop AVERYNAMAYA
06/13/2017 6:34 PM
The Lich Yard (Specter)
lol
3 4
Noah NoahthepikachuX3
06/13/2017 6:03 PM
Tower of Fate (Specter)
0 0
david majora998
06/13/2017 3:01 PM
Plains
2Player is so annoying
0 0
Ash UnderSeaSkies
06/13/2017 2:31 PM
Pridemoor Keep
I beat King Knight I beat King Knight
0 0
jude judeCB
06/13/2017 1:24 PM
Lost City (Specter)
IT WOULD'VE BEEN COOL BUT CHEAP IF MOLE KNIGHT HAD FIREBALLS
0 0
OmegaEldin OmegaEldin
06/13/2017 11:49 AM
Plains
1 0
jude judeCB
06/13/2017 10:21 AM
Pridemoor Keep (Specter)
IF KING KNIGHT IS THIS POWERFUL AND VERSATILE, I WANT TO PLAY AS HIM.
0 0
jude judeCB
06/13/2017 10:13 AM
Pridemoor Keep (Specter)
BRU WHEN IS THAT KING KNIGHT UPDATE/DLC GOING TO COME OUT?
3 0
jude judeCB
06/13/2017 10:07 AM
Iron Whale (Specter)
TREASURE KNIGHT IS LIKE WARIO, GREEDY BUT CAN DEFEND HIS LOOT.
0 0
jude judeCB
06/13/2017 10:05 AM
Iron Whale (Specter)
HEY NOBODY TOLD ME THE HOOK SHOT WAS ALLOWED.
0 0
jude judeCB
06/13/2017 10:03 AM
Iron Whale (Specter)
Best music LEVEL sound track I ever heard.
0 0
jude judeCB
06/13/2017 9:59 AM
Iron Whale (Specter)
TAKE THAT, YOU COOLED BLOODED FISH PUNK!! I KNOW YOUR WEAKNESS. AWESOME CLAWS, OR THE DREAD TALON.
4 0
mr chubby whitmerzach
06/13/2017 9:32 AM
The Lich Yard
i love this game
1 0
Justin epicsause21
06/13/2017 7:12 AM
Knuckler's Quarry
I ran into this odd music glitch where the music had duplicate copies of it playing at once
3 0
Justin epicsause21
06/13/2017 6:34 AM
Pridemoor Keep
I defeated a boss and the game told me to write a miiverse post
1 0
Syr TheWhit-Bees
06/13/2017 6:05 AM
Flying Machine
1 1
Bryan Brydawg29
06/12/2017 4:32 PM
Iron Whale (Specter)
I also eat pizza
5 0
Bryan Brydawg29
06/12/2017 3:33 PM
Stranded Ship (Specter)
eeezzZzzzzzzzzzzzzz and easy
1 0
cj charles904
06/12/2017 3:16 PM
Tower of Fate: Entrance (Specter)
Anyone else get mad when you can see the checkpoint and then die, having to hear the music over
3 0
Bryan Brydawg29
06/12/2017 3:02 PM
Tower of Fate (Specter)
GIT GUD
3 0
thomas kittybanana555
06/12/2017 2:59 PM
Plains
poop on me
3 0
Syr TheWhit-Bees
06/12/2017 1:58 PM
Missile Ride Mayhem
0 0
Sr. Amedo NotAmedo
06/12/2017 11:03 AM
Plains (Specter)
1 0
Syr TheWhit-Bees
06/12/2017 8:29 AM
Iron Whale
i hate u tresure guy
2 0
ZeroN ZeroN92
06/11/2017 8:17 PM
Rematch: Plague Knight
annoying lol
0 0
Bryan Brydawg29
06/11/2017 5:25 PM
Lost City (Specter)
can someone tell me where the last red skull is please
4 0
Kate znombie
06/11/2017 5:23 PM
Village
7 0
Bryan Brydawg29
06/11/2017 3:29 PM
Tower of Fate (Specter)
4 0
ryyan zeldamaster12436
06/11/2017 3:18 PM
Lost City
hi there person :3
2 0
Maxikinz Pempers
06/11/2017 1:00 PM
Village
0 0
µª®¥ Asellus314
06/11/2017 11:53 AM
Troupple Pond
13 1
daddy Sebasmont3
06/11/2017 11:22 AM
The Lich Yard (Specter)
this is fun and hard
4 0
#$?.,!' 0VIVES
06/11/2017 10:54 AM
Explodatorium
such a wimpy baby
0 0
springtrap oldschool1213
06/11/2017 10:25 AM
The Lich Yard
so hard!!!
2 0
mason tsenswampy12
06/11/2017 10:19 AM
Tower of Fate: ???? (Specter)
easier than i expected
2 0
mason tsenswampy12
06/11/2017 10:16 AM
Tower of Fate: ???? (Specter)
YES FINALLY!!!
0 0
mason tsenswampy12
06/11/2017 9:32 AM
Explodatorium (Specter)
STILL TOO EASY!!!!!!!!!!!!!!!
0 0
isaac caasi22
06/11/2017 5:34 AM
Avant-poste de l'Armurier
l' amibo ser a jouer a 2 co-oop et pouvoir avoir toutes les pouvoir du jeux en montent de niveaux
0 0
Frank Balloonboy3
06/11/2017 4:38 AM
Plains (Specter)
How do you beat the black knight in Specter Of Torment
2 0
гзď GermanSenpai
06/10/2017 8:49 PM
Plains
For Shovelry!
1 0
ALEXI10 sserra
06/10/2017 8:37 PM
Plains
i love cheese milk
2 0
mason tsenswampy12
06/10/2017 8:31 PM
Flying Machine (Specter)
REALLY REALLY REALLY EASY!!!!!!
0 0
mason tsenswampy12
06/10/2017 7:56 PM
Clockwork Tower (Specter)
STILL TOO EASY!!!!!!!!!!!!!
0 0
mason tsenswampy12
06/10/2017 7:32 PM
Memory of Conflict (Specter)
shield knight is sooo hard!!
0 0
mason tsenswampy12
06/10/2017 7:14 PM
Pridemoor Keep (Specter)
still too easy!!!!!!
0 0
mason tsenswampy12
06/10/2017 6:59 PM
Tower of Fate (Specter)
REIZE!??!
1 0
mason tsenswampy12
06/10/2017 6:48 PM
Lost City (Specter)
too easy
1 0
mason tsenswampy12
06/10/2017 6:22 PM
Iron Whale (Specter)
too easy
0 0
mason tsenswampy12
06/10/2017 6:08 PM
Iron Whale (Specter)
i look so cool in this pose
2 0
Dani Oh_Boy_08
06/10/2017 6:05 PM
Village
4 0
diego 2.0 dieoglpee
06/10/2017 5:32 PM
¡Qué cuca es!
!NO ME LO PUEDO PASAR!
1 0
Foxy NinjaKittyFish
06/10/2017 4:52 PM
Troupple Pond (Plague)
you died. want to share your thoughts on miiverse?
0 0
Foxy NinjaKittyFish
06/10/2017 4:43 PM
Plains (Plague)
get rickety wrecked
0 0
Foxy NinjaKittyFish
06/10/2017 4:38 PM
Plains (Plague)
it says something when the dragon is a cakeealk but a single pit takes hours
2 0
Foxy NinjaKittyFish
06/10/2017 4:37 PM
Plains (Plague)
whywhywhywhywhywhywhywhywhywhywhywhywhywhywhy
3 0
mitty mariokart8kinger
06/10/2017 3:45 PM
Frigid Flight
3 0
mason tsenswampy12
06/10/2017 2:21 PM
The Lich Yard (Specter)
that was shocking
1 0
mason tsenswampy12
06/10/2017 1:48 PM
Plains (Plague)
too easy
0 0
Gabriel Gabriel5963
06/10/2017 1:27 PM
Campiña
Cuando a quien invitas es bien noob
1 0
Matthew matthewsilmar16
06/10/2017 11:54 AM
Hall of Champions
Yay
0 0
swordx Sworddx
06/10/2017 11:25 AM
Plains
help
1 0
Matthew matthewsilmar16
06/10/2017 10:49 AM
Pridemoor Keep
YES!!
0 0
Pentaro Pentarillo
06/10/2017 10:41 AM
Encounter - Baz
5 0
Pentaro Pentarillo
06/10/2017 10:22 AM
Stranded Ship
10 0
Matthew matthewsilmar16
06/10/2017 10:22 AM
Troupple Pond
.....hmm
1 0
Vince mata2906
06/10/2017 10:16 AM
Clockwork Tower (Specter)
Im the dankest.
1 0
adrian c1ashcityrocker
06/10/2017 9:46 AM
Iron Whale
y angler not boss?
2 0
Pentaro Pentarillo
06/10/2017 9:46 AM
Encounter - Reize
2 0
liam firstada
06/10/2017 9:37 AM
Iron Whale
fun fact the purpleguards are mini boses on the level metal whale
0 0
juan jose juanjoseva
06/10/2017 9:34 AM
Village
finally beat propeller knight
5 0
Dawn webswebs
06/10/2017 9:08 AM
Plains (Specter)
ugh im stuck on a room thats in the the first level
2 0
Dad christelica
06/10/2017 8:28 AM
Troupple Pond
4 0
peter peterlovesraichu
06/10/2017 8:24 AM
Pridemoor Keep
easiest level, hardest mode
0 1
peter peterlovesraichu
06/10/2017 8:19 AM
Pridemoor Keep
go left at the beginning
1 0
Mikey 123Vine3Loogoo
06/10/2017 6:58 AM
Troupple Pond
2 0
Mikey 123Vine3Loogoo
06/10/2017 6:52 AM
Troupple Pond
how do thy fight thy mighty trouple king?
1 0
Paolo PaoloBenitez
06/10/2017 6:48 AM
Armería
y a este sapo como lo contento
1 0
Paolo PaoloBenitez
06/10/2017 6:45 AM
Armería
excelente juego el mejor juego del mundo ;D
0 0
Paolo PaoloBenitez
06/10/2017 6:33 AM
Armería
derrote la hechicera
0 0
Shawn Creepy_Hallway
06/09/2017 11:49 PM
Tower of Fate: Entrance (Plague)
man this is hard for plague night
0 0
kyle b supersonicson
06/09/2017 7:50 PM
The Lich Yard
i hate the boss
6 0
Eli lawson04
06/09/2017 7:14 PM
The Lich Yard (Specter)
yo specter op
4 0
mason tsenswampy12
06/09/2017 5:27 PM
Pridemoor Keep (Specter)
i hope king knight is harder then black knight
1 0
Leo awesomebro8
06/09/2017 3:13 PM
Tower of Fate (Specter)
o
1 0
Cactar chadmitchell44
06/09/2017 1:32 PM
The Lich Yard (Specter)
1 0
Bee–Man BeeMan21
06/09/2017 10:32 AM
Pridemoor Keep
I finnaly get to be Specter Knight!!!
0 0
Miguel mhoewell
06/09/2017 8:15 AM
Plains
o jogo é dimais
0 0
chase RobotChase4
06/09/2017 6:13 AM
Plains
3 0
chase RobotChase4
06/09/2017 6:05 AM
Plains
1 0
chase RobotChase4
06/09/2017 6:05 AM
Plains
0 0
Axel KissMineAxe
06/09/2017 5:13 AM
Lost City (Specter)
second time i`m playing this gamemode
0 0
EmoTastic Skeleton_Pelican
06/08/2017 11:07 PM
Explodatorium
0 0
Skyler AmzerLeeMarie
06/08/2017 10:26 PM
Tower of Fate (Specter)
i love this game
4 0
c. frog clappingfrog
06/08/2017 8:54 PM
Encounter - Baz
I finally beat Baz....after a two year hiatus.....
0 0
Pentaro Pentarillo
06/08/2017 6:50 PM
Lost City
8 0
James 789147heyydiary
06/08/2017 6:06 PM
Plains
i love cheat codes
2 0
chip monkeyboyman1965
06/08/2017 2:25 PM
Pridemoor Keep (Specter)
baaaa
2 0
AlphaSpade piggy202191
06/08/2017 2:06 PM
The Lich Yard
the hardest mini-boss
0 1
Cactar chadmitchell44
06/08/2017 12:57 PM
Lost City (Specter)
OMG Specter knight is now playable!!
3 0
Waterz09 zubia6
06/08/2017 10:20 AM
The Lich Yard
0 0
Aidan ahansen13579
06/08/2017 10:12 AM
Stranded Ship (Specter)
I need help
2 0
xmassTJ suzyque82
06/08/2017 8:28 AM
Explodatorium
warhorn is helpfull
2 0
xmassTJ suzyque82
06/08/2017 8:09 AM
The Lich Yard
0 trys he down
2 0
the_dude Bro-J-Simpson
06/08/2017 6:25 AM
Plains
hey guys
1 0
Marq young-peezy
06/08/2017 5:54 AM
Tower of Fate: ???? (Specter)
I can do this I beat it once
0 0
Henry GreenThunder909
06/07/2017 10:12 PM
Iron Whale (Plague)
Missiles are overrated!
0 0
Henry GreenThunder909
06/07/2017 9:32 PM
Pridemoor Keep (Plague)
Dirt blocks? Where we're going, we don't need dirt blocks...
0 0
logan loganwaker
06/07/2017 4:47 PM
Village
i beat mole knight after about the 50th try. noy sure to be proud or question my life skills
2 0
Henry GreenThunder909
06/07/2017 4:39 PM
Tower of Fate: ????
These blocks seem a bit fragile. A good shovel drop could make quick work of them.
1 0
JJ jjclay17
06/07/2017 4:21 PM
Tower of Fate (Specter)
I just started The Specter of Torment game and its cool. This is a great series.
4 0
Leo awesomebro8
06/07/2017 1:08 PM
Tower of Fate (Specter)
bored
0 0
Leo awesomebro8
06/07/2017 1:03 PM
Tower of Fate (Specter)
i just starded playing
2 0
Leo awesomebro8
06/07/2017 11:49 AM
Plains (Specter)
i am epic
3 0
joey chiefcool9
06/07/2017 8:37 AM
Tower of Fate (Specter)
where do you enter the cheat codes??
0 2
Henry GreenThunder909
06/06/2017 9:16 PM
Beeto's Big Break
This feels like a Mario Maker level.
5 0
Greyson Amychon
06/06/2017 7:21 PM
Plains (Specter)
TREASURE TROVE BOIS!!!!!!!
2 0
Bryan Brydawg29
06/06/2017 5:22 PM
Explodatorium
2 0
Bryan Brydawg29
06/06/2017 5:11 PM
Clockwork Tower
all you have to do to take out the first part in one hit is to use the thing that has the wheel ;)
0 0
Bryan Brydawg29
06/06/2017 4:39 PM
Village
2 0
carlo flyingblu123
06/06/2017 4:38 PM
Tower of Fate: Entrance (Specter)
hopes of achievement awaits...
0 0
Mr.Chibi triforcekirby
06/06/2017 3:18 PM
Village
when you have nothing left to buy... but you have a ton of money
5 0
Henry GreenThunder909
06/06/2017 2:21 PM
Lost City (Plague)
Literally the easiest thing I've faced so far.
0 0
tombstack cherryeanne
06/06/2017 2:14 PM
Village (Plague)
why is baz a minoin for?.
5 1
tombstack cherryeanne
06/06/2017 2:12 PM
Village (Plague)
why will this guy not let me to shovel knight,s village.? for!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
1 0
shawn ShawnC03
06/06/2017 1:56 PM
Pridemoor Keep (Plague)
I have so much health as plauge knight...
1 0
linkgamer jaynoahh
06/06/2017 1:00 PM
Iron Whale
omg
1 0
martin harrytwisted
06/06/2017 12:46 PM
The Lich Yard
fun
2 0
Leo awesomebro8
06/06/2017 12:32 PM
Village
1 0
Leo awesomebro8
06/06/2017 11:53 AM
Plains
i just started playing this
1 0
AlphaSpade piggy202191
06/06/2017 11:18 AM
Troupple Pond (Plague)
mole knight is noice
0 0
lightghost Jsparrow6
06/06/2017 7:48 AM
Forest of Fishing (Plague)
for some reason i think this is a bait bomb tutorial
4 0
tombstack cherryeanne
06/06/2017 5:02 AM
Tower of Fate (Specter)
why will mr. hat not be here
5 0
aiden landaid
06/05/2017 11:02 PM
Tower of Fate: ????
Play with two players. it's much easier for both The Enchantress and the final boss. :)
1 0
aiden landaid
06/05/2017 10:57 PM
Tower of Fate: ????
THIS BOSS SUCKS!!!!!
8 0
Bryan Brydawg29
06/05/2017 8:07 PM
Tower of Fate: Entrance
1 0
Bryan Brydawg29
06/05/2017 8:02 PM
Tower of Fate: Entrance
2 0
Monnie SkullKid3D2
06/05/2017 8:01 PM
Clockwork Tower (Specter)
one my favorite songs in the game
0 0
Cactar chadmitchell44
06/05/2017 7:40 PM
Tower of Fate (Specter)
2 0
Shadow minecraftX9000
06/05/2017 7:24 PM
Tower of Fate: Entrance (Specter)
umm... Black knight isn't shovel knight.. why does he care about shield knight?
2 1
Bryan Brydawg29
06/05/2017 7:11 PM
Frigid Flight
1 0
Bryan Brydawg29
06/05/2017 6:58 PM
Frigid Flight
1 0
Bryan Brydawg29
06/05/2017 6:26 PM
Clockwork Tower
don't be mean don't call people a short stak of pancakes
0 0
Bryan Brydawg29
06/05/2017 6:23 PM
Clockwork Tower
his supersain mode is super easy
0 0
SteveO steveo_ar_nlr
06/05/2017 5:56 PM
Pridemoor Keep (Specter)
1 0
Theopold!? tyoier
06/05/2017 3:48 PM
Plains
1 0
AlphaSpade piggy202191
06/05/2017 3:47 PM
The Lich Yard (Specter)
The spider scythe is VERY useful on this level!
3 0
Bryan Brydawg29
06/05/2017 3:42 PM
Troupple Pond
almost as good as the harlem shake
0 0
Flat Soda Thwomp1759
06/05/2017 3:10 PM
Tower of Fate (Specter)
whats good homeboy?
2 0
Flat Soda Thwomp1759
06/05/2017 3:08 PM
Plains (Specter)
nice rhino fgt
0 0
Flat Soda Thwomp1759
06/05/2017 2:55 PM
Plains (Specter)
2 0
FalconPain FalconPain
06/05/2017 12:56 PM
Grave Robber
So this is that Metroidvania thing everyone keeps talking about?
4 0
Lawrence BustaDaLockedOne
06/05/2017 12:51 PM
The Lich Yard
those specter knight darkness sections are so annoying
0 0
FalconPain FalconPain
06/05/2017 12:15 PM
Dirt Clod Dash
THRILL as a knight of the Order of No Quarter BALANCES HIS FINANCES!
4 0
rainbowdad disgustinjustin
06/05/2017 11:56 AM
Plains
gcbb
2 0
tombstack cherryeanne
06/05/2017 8:03 AM
Village
this guy kills me
4 0
tombstack cherryeanne
06/05/2017 7:59 AM
Village
i hate horoace
0 0
tombstack cherryeanne
06/05/2017 7:58 AM
Village
fisherman is link.
2 0
tombstack cherryeanne
06/05/2017 7:56 AM
shortcut?
phantom striker - COIN = COins
0 0
tombstack cherryeanne
06/05/2017 7:49 AM
Troupple Pond
boss shield knight
6 0
tombstack cherryeanne
06/05/2017 7:34 AM
Armor Outpost
dark reize
1 0
Blaze awesomeauron
06/04/2017 9:03 PM
Explodatorium
im gonna battle plague knight im gonna die a lot like a lot im gonna die
1 0
Robert knightking47
06/04/2017 8:58 PM
Troupple Pond
This dance is FRUIT-iful, no TROUT about it!
4 1
DrewU Pinzyman5000
06/04/2017 8:03 PM
Beeto's Big Break
#tormented
0 0
This Pleb p.a.c.3
06/04/2017 7:11 PM
Plains (Specter)
in name choosing name screen for s.o.t type SP&JOHNY to play wearing donovans origional armor
4 0
Sam sampootis
06/04/2017 5:38 PM
Tower of Fate: ???? (Specter)
Final boss is impossible.
1 0
tombstack cherryeanne
06/04/2017 4:57 PM
Village (Plague)
na!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
9 0
Nathan xThePkmnMasterx
06/04/2017 4:29 PM
Village
Finally beated Scepter Knight!! :)
4 0
Gerardo GemMaster100
06/04/2017 4:17 PM
Plains
playing this game again. Love it!!!!
1 0
Greg G_Van28
06/04/2017 3:16 PM
Stranded Ship (Specter)
lol i love how he makes the entire floor spikes thats so awesome lmao
0 0
Tavares Tavares2105
06/04/2017 2:58 PM
Pridemoor Keep
just beat specter of torment today!
0 0
Theopold!? tyoier
06/04/2017 2:50 PM
Lost City (Specter)
What a long level...
0 0
DrPenguin DrPenguini_69
06/04/2017 2:34 PM
Explodatorium
that was easy
3 0
Theopold!? tyoier
06/04/2017 2:26 PM
Tower of Fate (Specter)
R-R-reiz?! How did you get here!!!??????
9 0
Theopold!? tyoier
06/04/2017 2:09 PM
The Lich Yard (Specter)
Yay! First try!
0 0
Theopold!? tyoier
06/04/2017 2:04 PM
The Lich Yard (Specter)
DENIED!
0 0
Theopold!? tyoier
06/04/2017 1:32 PM
Iron Whale (Specter)
YAHOOOOOOOOOOOOOOOOO!
0 0
Theopold!? tyoier
06/04/2017 1:21 PM
Iron Whale (Specter)
WOA! I ALMOST FELL OUT OF THIS LEVEL!
0 0
Theopold!? tyoier
06/04/2017 1:02 PM
The Lich Yard (Specter)
That Boneclang is DANCING!
3 0
Theopold!? tyoier
06/04/2017 12:49 PM
Flying Machine (Specter)
---
0 0
Theopold!? tyoier
06/04/2017 12:43 PM
Plains
YAHOOOOOOOOOOO
0 0
Theopold!? tyoier
06/04/2017 12:39 PM
Plains
*GAAAAAAAASP*Dan FROM THE DIAMOND MC?
0 0
Theopold!? tyoier
06/04/2017 12:34 PM
Plains
Body swap? What's that?
1 0
Theopold!? tyoier
06/04/2017 12:31 PM
Plains
Beeto: Gah! Stop telling that fairy to hurt me!
3 0
Theopold!? tyoier
06/04/2017 12:25 PM
Pridemoor Keep
0 0
Theopold!? tyoier
06/04/2017 12:18 PM
Pridemoor Keep
Fairy dance!
2 0
Theopold!? tyoier
06/04/2017 12:14 PM
Pridemoor Keep
Fairy fun!
3 0
Gavin KarateStar529
06/04/2017 11:25 AM
Explodatorium
this guy is a B@STERED
1 0
Theopold!? tyoier
06/04/2017 10:55 AM
Stranded Ship (Specter)
uh oh
0 0
Theopold!? tyoier
06/04/2017 10:27 AM
Explodatorium (Specter)
What flame?
0 1
Theopold!? tyoier
06/04/2017 10:26 AM
Explodatorium (Specter)
I DON'T PLAY THE SONIC GAMES, YET THIS REMINDS ME OF THIS!
1 0
Theopold!? tyoier
06/04/2017 10:13 AM
Tower of Fate (Specter)
I wonder who Manny is...
10 0
Theopold!? tyoier
06/04/2017 10:10 AM
Plains (Specter)
Discount Bowser. (1 Gamesin)
1 0
Theopold!? tyoier
06/04/2017 9:57 AM
The Lich Yard (Specter)
GAH!
1 0
CARL ELSim1
06/04/2017 9:56 AM
Encounter - Reize
Heck yeah i did it. SUPER hard game but nice looking.
0 0
Theopold!? tyoier
06/04/2017 9:54 AM
The Lich Yard (Specter)
Damage boost FTW!
0 0
Theopold!? tyoier
06/04/2017 9:45 AM
The Lich Yard (Specter)
um
0 0
Theopold!? tyoier
06/04/2017 9:45 AM
The Lich Yard (Specter)
Specter: GET OUT OF MY ROOM! Shovel: I thought it was in THE TOWER, if you had a room
1 0
Theopold!? tyoier
06/04/2017 9:41 AM
The Lich Yard (Specter)
How is the dark NOT in those other rooms?
0 0
Theopold!? tyoier
06/04/2017 9:38 AM
The Lich Yard (Specter)
Physics? What are those?
1 0
Theopold!? tyoier
06/04/2017 9:36 AM
The Lich Yard (Specter)
Wall running? What's that?
1 0
Theopold!? tyoier
06/04/2017 9:35 AM
The Lich Yard (Specter)
How to Dash-Slash: 1: Jump. 2: Press the Attack button.
0 0
Bastion mtsmith888
06/04/2017 9:29 AM
Pridemoor Keep
how to get past the book part
2 0
patrick blastfield
06/04/2017 7:48 AM
Plains
just got treasure trove cool game
3 0
-_-berry ö enitsuj123
06/03/2017 7:39 PM
Plains
cfgt
5 0
wynn night136
06/03/2017 6:24 PM
Plains (Specter)
anyone else like playing as specter night? cause i do!
2 0
R★Ronaldo DatPizza548
06/03/2017 6:00 PM
Pridemoor Keep
just killed specter knight AND King knight
1 0
YTGameBros N3_PyRo
06/03/2017 2:27 PM
The Lich Yard
this guy sucks!
1 0
Rufo Rufax6
06/03/2017 1:44 PM
Fortaleza del Orgullo
:v
1 0
WILL gamingwizard1210
06/03/2017 1:33 PM
Tower of Fate: Entrance
Yassssssssssss!!!!!
7 0
Jackypoo jamek87
06/03/2017 12:34 PM
Tower of Fate (Specter)
this game is so easy. i beated the 3DS version and wii u.
1 0
isaac omgods
06/03/2017 9:14 AM
Village
aw jeez kid im sorry
3 0
Pentaro Pentarillo
06/03/2017 8:58 AM
Iron Whale
7 0
Pentaro Pentarillo
06/03/2017 8:39 AM
Explodatorium
14 0
UpsideDown momer13
06/03/2017 8:12 AM
Pridemoor Keep
this game is way too hard
2 0
Adam dodger1024
06/03/2017 8:03 AM
Plains
I Like this game
1 0
gatitapeac Keiry-12345kitty
06/03/2017 6:10 AM
Campiña (Specter)
son muy chistosos me gusti el juego
1 0
Sam Popdude36
06/02/2017 10:48 PM
Tower of Fate (Specter)
yo boi
3 0
Pentaro Pentarillo
06/02/2017 9:03 PM
The Lich Yard
4 0
jonah jonahjerymiah
06/02/2017 8:05 PM
Village
2 0
jonah jonahjerymiah
06/02/2017 7:53 PM
Village
whoever plays this game give me a vertify
8 0
Sans SkybladeMaster
06/02/2017 6:50 PM
Clockwork Tower
na fam
0 0
wierd guy Adriansnotaninja
06/02/2017 5:31 PM
Plains
AHHH stupid thing
0 0
Jake SONICRULES2012
06/02/2017 4:57 PM
Pridemoor Keep (Plague)
I came into pridemore keep with 7010$ and i'm leaving with 1182$ PLEASE END MY SUFFERING
1 0
pro.oak Bas3dL0rD
06/02/2017 4:39 PM
Memory of Adventure (Specter)
ok specter knights real name is donovan :l
0 0
CLAMP EXCLAMATIONPOINT
06/02/2017 4:05 PM
Plains
0 0
Thomas reliefpizza14
06/02/2017 2:35 PM
Tower of Fate (Specter)
just started back up my game+ file
2 0
tombstack cherryeanne
06/02/2017 1:25 PM
Tower of Fate (Specter)
in your face phantom striker
3 0
Red GAMERDMAN007
06/02/2017 12:21 PM
Tower of Fate (Specter)
yaaaaaqyyyy (^o^) (^o^)
3 0
Red GAMERDMAN007
06/02/2017 12:20 PM
Tower of Fate: Entrance (Specter)
yaaaaayyyy
0 0
Red GAMERDMAN007
06/02/2017 11:59 AM
Lost City (Specter)
oooo yaaaa
0 0
Red GAMERDMAN007
06/02/2017 11:56 AM
Lost City (Specter)
hi aaaalll
3 0
Plumfiggle jojo9500
06/02/2017 11:53 AM
Tower of Fate: ???? (Plague)
best final bosses in the 3. dark pk was awesome, music, background, concept. yacht club is amazing
2 0
Red GAMERDMAN007
06/02/2017 11:49 AM
Explodatorium (Specter)
yaaaaaayyyy
0 0
Red GAMERDMAN007
06/02/2017 9:40 AM
Memory of Conflict (Specter)
(^o^)
0 0
Roo Chance4903
06/02/2017 8:35 AM
Lost City
I hate the explodeitarium
1 0
isaac omgods
06/02/2017 8:20 AM
Village (Plague)
ive done it! pandemonium cloak get!
3 0
Taylor ClumsyTaylor
06/01/2017 9:27 PM
Tower of Fate (Specter)
5 0
Taylor ClumsyTaylor
06/01/2017 8:08 PM
Plains (Plague)
1 0
Adypi Aidypie
06/01/2017 7:18 PM
Lost City
5 0
Edison Edison_Tse
06/01/2017 6:37 PM
Flying Machine (Plague)
I didn't die yet???????
0 0
samuel lawarner
06/01/2017 6:36 PM
Rematch: Specter Knight
Same
1 0
JT 4Strong
06/01/2017 5:19 PM
Iron Whale (Specter)
checkpoint before boss door in treasureknights stage looks familiar
1 0
JT 4Strong
06/01/2017 4:41 PM
Flying Machine (Specter)
it is really hard
6 0
Sky SkatetoLOL
06/01/2017 2:20 PM
Tower of Fate (Specter)
I can't help but just play the stages again and again. It's really fun to do!
3 0
Faucet Faucet02
06/01/2017 1:58 PM
Tower of Fate (Specter)
Hello.
3 0
aidenhay aidenhay
06/01/2017 12:06 PM
Village
ayyyyy
3 0
JackCat694 Ravendrum
06/01/2017 11:15 AM
Plains
AAAAAAAAAAAAARRRRRRRRRRRRRRRGGGGGGGGGGGGGGGHHHHHHHHHHHHHHH!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
1 0
JackCat694 Ravendrum
06/01/2017 11:13 AM
Plains
i am getting sick of dying in a ******* ***** **** level thatis easy
0 0
Jakee bratticus33
06/01/2017 10:39 AM
Plains
Playing Shovel Knight Co-Op! Only now I'm noticing how weird multiplayer mechanics really are...
0 0
zachmattzo atnextc
06/01/2017 8:59 AM
Clockwork Tower (Specter)
this is imposible
2 0
nick prfont
06/01/2017 5:33 AM
The Lich Yard (Specter)
ehcks dee
0 0
luis Luis6438
05/31/2017 6:16 PM
Campiña (Plague)
3 0
Dylan DSFreako
05/31/2017 5:17 PM
Plains (Plague)
Playing with the Pandemonium Cloak cheat code! (Just eneter your name as PL&CIPH)
2 0
Bert Canadia.com
05/31/2017 2:24 PM
Iron Whale (Specter)
What?
0 0
Ness Vunny_Bunny
05/31/2017 1:47 PM
Plains
Woooooooa, this is neat
5 0
Boss Man Caravan25
05/31/2017 11:26 AM
Clockwork Tower (Specter)
i've always hated moving levels ever since Mario Bros. 3
2 0
Boss Man Caravan25
05/31/2017 11:15 AM
Clockwork Tower (Specter)
robo rinos?
0 0
JfWood catocat9001
05/31/2017 10:56 AM
Plains
infinite coooooiiiiinss
1 0
Boss Man Caravan25
05/31/2017 10:44 AM
Troupple Pond
its not a dance he's having a bad seazier
2 0
Jewfro imaginemesusan
05/30/2017 10:52 PM
Pridemoor Keep (Plague)
0 0
Jewfro imaginemesusan
05/30/2017 10:47 PM
Pridemoor Keep (Plague)
0 0
Cotias Cotias389
05/30/2017 4:58 PM
O Jardim do Espectro (Specter)
muito bom o game!
3 0
Joey krawky398
05/30/2017 2:37 PM
Rematch: Treasure knight
Close-range Alchemy!
0 0
Joey krawky398
05/30/2017 2:36 PM
Rematch: Shovel Knight
The most fun way to beat Shovel Knight is breaking his AI and spamming bombs.
1 0
Sans Ethenh2006
05/30/2017 2:21 PM
Tower of Fate (Specter)
4 0
jordan kidz42
05/30/2017 2:01 PM
Plains (Plague)
tgshrtcrjh
1 0
Adypi Aidypie
05/30/2017 1:02 PM
Flying Machine (Plague)
You can use a Vat to easily block the wind currant and access the secret!
2 0
Matt Shadeandfreud
05/30/2017 8:21 AM
Clockwork Tower (Specter)
Spectre Knight is the best Shovel game, discuss.
1 0
Glen robotdude777
05/30/2017 8:20 AM
Beeto's Big Break
0 0
Luke booyakasha1976
05/30/2017 7:46 AM
Tower of Fate: ???? (Specter)
the final boss fight is IMPOSSIBLE
2 0
Sky arielintheocean
05/30/2017 6:43 AM
Plains (Plague)
I love that this is free!
1 0
Luke booyakasha1976
05/30/2017 6:17 AM
Tower of Fate: Entrance (Specter)
#dugeonsohard
2 0
Trent TKPrime
05/30/2017 5:25 AM
Pridemoor Keep (Plague)
i am almost there!
2 2
ΛΖΞПΛЯ 1© AZENAR1
05/29/2017 7:13 PM
Stranded Ship (Specter)
Every one try out the super god mode for specter knight it's so fun. Code is TVSVUEIO
1 0
David LinkGamer
05/29/2017 6:42 PM
Tower of Fate (Specter)
Shovel Knight is one of the best games ever
8 0
jude judeCB
05/29/2017 5:24 PM
The Lich Yard (Specter)
GET THAT CRUD OUT OF MY HOUSE!!! BEAT IT PHANTOM STRIKER!!
2 0
Jason Da_Ranger
05/29/2017 5:20 PM
The Lich Yard (Plague)
i hate specter knights stage
4 0
jude judeCB
05/29/2017 5:11 PM
Tower of Fate: Entrance (Specter)
BOOYAH TAKE THAT BLACK KNIGHT! NEVER MESS WITH SPECTER KNIGHT!!
0 0
Shananer toastking12
05/29/2017 5:06 PM
Explodatorium (Specter)
heh
1 0
Jason Da_Ranger
05/29/2017 3:55 PM
Plains (Plague)
finally i unlocked plague of shadows
1 0
doofyplayr pmuser
05/29/2017 3:25 PM
The Lich Yard
i suck at this boss
0 0
tombstack cherryeanne
05/29/2017 3:09 PM
Village
1 0
Myles Jmnewcomb88
05/29/2017 2:11 PM
Village
this is hard!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
1 0
Alli The_Doctor_SHER
05/29/2017 1:42 PM
The Lich Yard
dcbadfEXNJMDAWGK'UERBKKKXFJ spector knight i hate you
1 0
isaac omgods
05/29/2017 1:41 PM
Lost City
best relic bois
0 0
kyle b supersonicson
05/29/2017 11:59 AM
The Lich Yard (Plague)
2 0
Garrett SydNoze
05/29/2017 11:53 AM
Tower of Fate: Entrance
2 1
Josh ThatJoshHoover
05/29/2017 11:36 AM
Plains
1 0
Nick AlbinoLucario
05/29/2017 11:14 AM
Explodatorium (Plague)
When you win without destroying the grey blocks
2 0
☆JulianEX☆ BABYBOOMBOOM
05/29/2017 10:25 AM
Tower of Fate: ???? (Plague)
is it me? or are all the 3 final bosses almost the same?
3 0
Abraham a-rocks
05/29/2017 9:31 AM
Clockwork Tower (Specter)
Im am horribke at this level! UUH
1 0
Andrew swishyboy15
05/29/2017 9:16 AM
Iron Whale (Specter)
Oh no I'm not falling for that again. *Opens chest anyway*
3 0
Luke booyakasha1976
05/29/2017 9:15 AM
Tower of Fate (Specter)
mole knight is so easy
3 0
PL1 barrettbros
05/29/2017 9:15 AM
Troupple Pond
Trouple my main man
1 0
littlebudy littlebuddy75
05/29/2017 8:55 AM
The Lich Yard
somnwone play with me
8 2
Andrew swishyboy15
05/29/2017 8:49 AM
Lost City (Specter)
I like the whole rebound mechanic they have going on here.
1 0
Chance Chordmaster
05/29/2017 8:47 AM
Explodatorium
I cant beat plague knight can anyone help
1 0
kenny skittleboy2002
05/29/2017 8:33 AM
Plains
the butt code is x&butt use it but you will not get feats if you use it
0 0
kenny skittleboy2002
05/29/2017 8:31 AM
Plains
sup
0 0
Luke booyakasha1976
05/29/2017 7:42 AM
The Lich Yard (Specter)
how do you get to 5th checkpoint
0 0
Marq young-peezy
05/29/2017 7:26 AM
Armor Outpost
I need a boss to defeat
2 0
PL1 barrettbros
05/29/2017 6:50 AM
The Lich Yard
MUST HAVE FOOD >:3
1 0
Chris Hegs75
05/29/2017 4:26 AM
Lost City
1 0
Xavier theopmudkip
05/28/2017 8:23 PM
Plains
5 0
Ivan shrimbum
05/28/2017 8:18 PM
Pridemoor Keep
1 1
Berny Majora567
05/28/2017 7:53 PM
Lost City
3 0
Berny Majora567
05/28/2017 7:49 PM
Lost City
4 0
Elijah coolioe12
05/28/2017 6:26 PM
Plains
i dig this
2 0
gabi gabi1520
05/28/2017 5:01 PM
Torre do Relógio
rumo ao final !!
0 0
Evan sonof9finger
05/28/2017 4:05 PM
Plains
hfdshdd,unhsgsbbfmfhggfygg
1 0
Jonah Amircse
05/28/2017 4:01 PM
Troupple Pond
troupple dance is the best dance lol
3 0
gabi gabi1520
05/28/2017 4:00 PM
Baleia de Ferro
esse jogo é d+++++....
0 0
Evan sonof9finger
05/28/2017 3:56 PM
Plains
jjhvndhdggdkjmmvjdhfhthhf
2 0
Evan sonof9finger
05/28/2017 3:55 PM
Plains
2 0
Jonah Amircse
05/28/2017 3:52 PM
Pridemoor Keep
Use chaos orb and bounce attacks!
0 0
conor liamct
05/28/2017 3:30 PM
Tower of Fate (Specter)
love the new update
6 0
Daniel Danidambro
05/28/2017 2:57 PM
Torre do destino (Specter)
Marvelous!!
1 0
Jairo jairomata123
05/28/2017 2:46 PM
The Lich Yard (Specter)
They should make an update where you have to fight eachother like battlemode or something
0 0
Waddle dee Rahimihouse
05/28/2017 2:36 PM
The Lich Yard (Specter)
I think he is pure op
1 0
kronno zom wencherenguez
05/28/2017 1:19 PM
Campiña (Specter)
lo derrote
2 0
Outlaw thonyswall
05/28/2017 10:39 AM
Tower of Fate (Specter)
I did this for money >:(
3 1
samandalex cowboyfans16
05/28/2017 10:29 AM
The Lich Yard
multiplayer rocks
0 0
Kohen kkmac13
05/28/2017 10:28 AM
Troupple Pond
I like the ichor of renwal.What ichor do you like?
1 0
lightghost Jsparrow6
05/28/2017 10:18 AM
The Lich Yard
9 0
Jason tamarastpierre
05/28/2017 9:41 AM
Pridemoor Keep
5 0
samandalex cowboyfans16
05/28/2017 9:30 AM
Village
i liie the up dates
1 1
Jaruto! jarutoatd
05/28/2017 8:33 AM
Lost City (Specter)
I swear, this game is so well made that i cant be mad when i die
2 0
fred boddabing
05/28/2017 8:27 AM
Plains
this is awesome
1 0
Jacob zTehBeast
05/28/2017 8:25 AM
Tower of Fate: Entrance
end me
2 0
Kro kevdwarf
05/28/2017 8:13 AM
The Lich Yard
Danny=Best Grump
1 0
Venomous VenomousFox
05/28/2017 6:55 AM
Explodatorium
i can't beat it.
1 0
tombstack cherryeanne
05/28/2017 5:56 AM
Iron Whale
1 0
Nova radioactivegrunt
05/27/2017 10:06 PM
Troupple Pond
this game is nifty
4 0
Boss Man Caravan25
05/27/2017 8:32 PM
Plains (Specter)
FOOL challenge the undead and die
2 0
Boss Man Caravan25
05/27/2017 8:20 PM
Plains (Specter)
this almost dosnt seem fare
1 0
Boss Man Caravan25
05/27/2017 8:17 PM
Plains (Specter)
what else world be the start screen
2 0
JAM★ Ninjaraffeicorn
05/27/2017 7:40 PM
Lost City
2 0
Jake SONICRULES2012
05/27/2017 7:04 PM
Flying Machine (Specter)
this game rustles my jimmies. nuf sed
1 0
ShAdOw?!? fcsaxshadow
05/27/2017 7:03 PM
Explodatorium (Specter)
this game 10/10!
7 0
Jake SONICRULES2012
05/27/2017 6:51 PM
Tower of Fate (Specter)
5 0
jude judeCB
05/27/2017 5:42 PM
Flying Machine (Specter)
GOD D*MNIT PROPELLER KNIGHT! I'M PAYING FOR THAT!
2 0
jude judeCB
05/27/2017 5:34 PM
Flying Machine (Specter)
HAVE AT YOU! YOU GYROSCOPIC JESTER!
2 0
jude judeCB
05/27/2017 4:55 PM
Lost City (Specter)
plague knight is ok I'll give that
0 0
2MLG4U angela1018
05/27/2017 4:54 PM
Flying Machine (Specter)
dis hard
5 0
bob childless
05/27/2017 3:53 PM
Tower of Fate (Specter)
whats your favorite weapon
0 0
jude judeCB
05/27/2017 3:36 PM
Iron Whale (Specter)
that fish is a super mario bros 3 idea
2 0
sofi saints-9907
05/27/2017 3:12 PM
Plains
Did anyone else get triggered?
1 0
ninja oce dope_yoshi
05/27/2017 2:47 PM
Plains
hi world
0 0
joãogui joaoguilherme10
05/27/2017 1:30 PM
Torre do destino (Specter)
0 0
leon butt LeonTheDestroyer
05/27/2017 1:20 PM
Pridemoor Keep
pkyesddm
2 0
♪♪♪♪♪♪♪oz… spacechick365
05/27/2017 12:57 PM
Village
2 0
♪♪♪♪♪♪♪oz… spacechick365
05/27/2017 12:55 PM
Plains
djwfcjfg
1 0
Ariann ariann.hobbit
05/27/2017 12:50 PM
Máquina Voladora
odie éste stage salvaje
0 0
nkirby1 nkirby1
05/27/2017 12:38 PM
Tower of Fate (Specter)
with a giant skeleton lol
6 1
Jaden jadenator123
05/27/2017 12:24 PM
The Lich Yard (Specter)
Specter Knight is awesome
1 0
Ben Nebjamin
05/27/2017 12:15 PM
Pridemoor Keep
0 0
Jewce PiemanDaSuper
05/27/2017 11:27 AM
Pridemoor Keep
just defeated queen knight, im lonely
0 0
Enmanuel eScythe
05/27/2017 10:28 AM
Tower of Fate (Specter)
Aarghh!
3 0
Jimmy JimmyJacob
05/27/2017 9:24 AM
Tower of Fate: ????
1 0
Josh reileys04
05/27/2017 7:59 AM
The Lich Yard
1 0
Josh reileys04
05/27/2017 7:56 AM
The Lich Yard
1 0
JT 4Strong
05/27/2017 7:50 AM
The Lich Yard (Specter)
lich striker is not in shovel knight
0 0
SkyGuard SkyGuarders
05/27/2017 6:48 AM
Plains (Specter)
omg i actually beat the boss without taking damage :0
1 0
Logan Wii3Boyz
05/27/2017 6:39 AM
Troupple Pond
fish in the pond see what happens [._.]
1 0
Rhett Rhett701
05/27/2017 6:36 AM
Plains (Specter)
3 0
SkyGuard SkyGuarders
05/27/2017 6:26 AM
Rematch: King Knight
Have you ever had a dream that you beat the boss without taking damage? Well my dreams came true. :)
3 0
Drew D Dalek06
05/27/2017 4:51 AM
Lost City (Plague)
i hate the parts where you have to bounce on the lava
0 0
Quincy blackbird1030
05/27/2017 1:39 AM
Plains (Specter)
i like this game alot
4 0
Warewolf Ianthegbafan
05/26/2017 8:52 PM
The Lich Yard
me too
1 0
linebrow BRADLEYSWEET
05/26/2017 8:42 PM
Clockwork Tower (Specter)
Steel thy... Uh... Sythe! That! The weapon I am currently using! Steel it! But dont steal it. What?
5 0
Glen robotdude777
05/26/2017 6:45 PM
Village (Plague)
will they come out with a king knight game?
10 1
Glen robotdude777
05/26/2017 6:40 PM
Troupple Pond (Plague)
king knight for life
1 0
Andres supergamer1225
05/26/2017 6:36 PM
Tower of Fate (Specter)
Press down in front of the kitten
8 0
Andres supergamer1225
05/26/2017 6:20 PM
Tower of Fate (Specter)
Its harder on new game plus!!
2 0
Andres supergamer1225
05/26/2017 6:17 PM
Tower of Fate (Specter)
Use Judgement Rush to skip sum parts ;)
3 0
Jake SONICRULES2012
05/26/2017 6:11 PM
Plains (Specter)
JUST FOUND OUT THAT YOU DON'T NEED TO UNLOCK SPECTRE OF SHADOWS!!!!!!!!!
2 0
XPRTGUNNER XPRTGUNNERNTWU
05/26/2017 5:54 PM
Plains
wee
3 0
tombstack cherryeanne
05/26/2017 5:21 PM
Forest of Phasing
5 0
H Quack5
05/26/2017 5:20 PM
Plains (Specter)
I love spectral knight
0 0
Jacob zTehBeast
05/26/2017 3:07 PM
Tower of Fate: Entrance
Wish me luck!
2 0
Justin L0rdVad3r456
05/26/2017 2:40 PM
Explodatorium
how do i beat this patrt
1 0
sonic juni-javier
05/26/2017 2:32 PM
Plains (Specter)
5 0
mitty mariokart8kinger
05/26/2017 2:07 PM
Explodatorium
DAAAAAAMN almost died
1 0
andrew drewdown817
05/26/2017 2:00 PM
Explodatorium
yvhgj
1 0
τε⇒ ΐςααс zactrak
05/26/2017 1:31 PM
Pridemoor Keep (Specter)
Just beat King knight with specter knight (^-^)
3 2
****** Digipengiun2
05/26/2017 1:14 PM
Iron Whale (Specter)
in the ocean
0 0
****** Digipengiun2
05/26/2017 1:13 PM
Iron Whale (Specter)
Like if rawr
0 0
ALEX ALEXCRAFTcat
05/26/2017 12:13 PM
La Ciudad Perdida
0 0
James Batman2062
05/26/2017 12:11 PM
Tower of Fate (Specter)
7 0
SUPER BEN stjoeleo
05/26/2017 11:56 AM
Flying Machine (Plague)
first checkpoint and i am already wanting to die
1 0
Luna PugachuXL
05/26/2017 11:37 AM
The Lich Yard
co op is pretty hard to get used to xD
3 0
Andrew swishyboy15
05/26/2017 10:39 AM
Iron Whale
This stage has my favorite music.
1 0
max mario5861
05/25/2017 7:46 PM
Tower of Fate: ???? (Specter)
im losing all hope on this level
0 0
Julius skeloplayer123
05/25/2017 7:17 PM
Plains
how to get past?
1 0
mitty mariokart8kinger
05/25/2017 6:27 PM
Beeto's Big Break
FUUUUUUCK
3 0
Blu BluTallulah
05/25/2017 6:25 PM
Stranded Ship (Plague)
0 0
Ant Najuuk
05/25/2017 3:11 PM
Plains
Fell beast laid a most cunning trap, making it's nest over a Pit
5 0
Aidan ChickenSkylander
05/25/2017 1:43 PM
Flying Machine
Propeller Knight cries when he dies!
0 0
Roosevelt potato3
05/25/2017 12:26 PM
Plains (Plague)
easy af
1 0
GregoryN4 GBereU
05/25/2017 12:05 PM
Plains
Shovel Justice
0 0
Obsa :3 KanjiMage64
05/25/2017 8:47 AM
Fortaleza del Orgullo (Specter)
jajaja
0 0
mitty mariokart8kinger
05/24/2017 5:47 PM
Plains (Plague)
0 0
mitty mariokart8kinger
05/24/2017 2:54 PM
Tower of Fate (Specter)
DAMNIT!!
1 0
xmassTJ suzyque82
05/24/2017 1:07 PM
Explodatorium
war horn is helpfull
0 0
clayton alaphnull
05/24/2017 12:54 PM
Plains
2 0
Cam traydfull
05/24/2017 8:10 AM
Tower of Fate (Specter)
Chrono coin slows down the rising water
2 0
Rivet Gear DragonLord4444
05/24/2017 6:44 AM
The Lich Yard (Plague)
For anyone who has made it here, this is the ending area where specter knight put the locket
3 0
Judas ^_^ Pahnpahn315
05/24/2017 5:57 AM
Village
This game is fun on the Bun
1 0
xmassTJ suzyque82
05/23/2017 9:22 PM
Troupple Pond
there is a hack when the king is dancing to some cool music!
1 0
Mr.Chibi triforcekirby
05/23/2017 7:39 PM
Tower of Fate (Specter)
just rektd prop knight
2 0
xmassTJ suzyque82
05/23/2017 7:12 PM
Tower of Fate: Ascent
is there a code where you can be king knight
2 0
galaganerd baconbros98
05/23/2017 6:46 PM
Tower of Fate: Entrance (Plague)
sometimes, you just gotta look inside yourself and say "what am i willing to put up with today?"
3 0
Joe shmelmick
05/23/2017 6:39 PM
Tower of Fate (Specter)
game rocks
5 0
Linkz4 Linkz4
05/23/2017 6:34 PM
Plains
0 0
Jaey jaeybird
05/23/2017 5:41 PM
Tower of Fate: Ascent
Why is everyone complaining about Polar knight He/She's easy
1 0
SUPER BEN stjoeleo
05/23/2017 5:40 PM
Flying Machine
FFFFFFFFF
0 0
fatloselol adrian500763
05/23/2017 5:38 PM
Explodatorium
omg i cannot bet this!
1 0
pedroUSA mewtwoPG
05/23/2017 5:33 PM
Máquina Voadora (Specter)
PAO DE BATATA
1 0
adrian esteban8707
05/23/2017 4:25 PM
Plains (Plague)
to hard
1 0
adrian esteban8707
05/23/2017 4:24 PM
Plains (Plague)
2 0
adrian esteban8707
05/23/2017 4:13 PM
Plains (Specter)
5 0
xmassTJ suzyque82
05/23/2017 3:55 PM
Plains (Plague)
did you now this is not new it was here when you defeat the first companion
4 0
SUPER BEN stjoeleo
05/23/2017 2:57 PM
The Lich Yard
easy 4 me
0 0
PikaGamer pnavaja26
05/23/2017 2:49 PM
Village
Its cool for me
3 1
Me NinjaTree71
05/23/2017 2:32 PM
Encounter - Baz (Plague)
man the component powder made this real easy
1 0
Starret Keyotea
05/23/2017 2:10 PM
Flying Machine
I have grounded Propeller Knight.
0 0
Starret Keyotea
05/23/2017 2:06 PM
Flying Machine
I have grounded Perpendicular Knight.
3 0
Robin Seblin1
05/23/2017 1:47 PM
Dirt Clod Dive
4 0
xmassTJ suzyque82
05/23/2017 11:27 AM
Iron Whale
now! get me the money
0 0
Q SCP-963
05/23/2017 8:53 AM
Flying Machine (Specter)
"are you sure you want to go to the Flying Machine?" no but I missed a skull so I gotta.
2 0
Devon ShyGuyLuigi282
05/22/2017 8:54 PM
Tower of Fate: ???? (Plague)
but you get knocked around so much that its just a pain.
0 0
Devon ShyGuyLuigi282
05/22/2017 8:52 PM
Tower of Fate: ???? (Plague)
its fine to have an arena where it falls apart and you can destroy yourself if youre not careful, +
0 0
GamerDoge tdk91106
05/22/2017 6:04 PM
Explodatorium
AMIIBO KIGHT AT LEVEL 50 MAX!!!
1 0
jesusgrump themainjesus
05/22/2017 5:54 PM
Flying Machine (Specter)
help
4 0
Jacob zTehBeast
05/22/2017 5:41 PM
Troupple Pond
The dance is my favorite thing in this game
1 0
Jacob zTehBeast
05/22/2017 5:05 PM
Iron Whale
What's the best armor to use?
0 1
HipstaDeer BuilderOfStuff
05/22/2017 4:46 PM
Plains
Ow
1 0
Glen robotdude777
05/22/2017 4:14 PM
Tower of Fate (Specter)
i finished the game
2 0
alexander gamezonerepair
05/22/2017 3:40 PM
Torre del Hado (Specter)
agare todos los guesos rojos y tengo a donovan
3 0
witchyTea DankWitchyMemez
05/22/2017 2:34 PM
Plains
5 0
Mikey 123Vine3Loogoo
05/22/2017 2:18 PM
Explodatorium
0 0
Knight TeamKnight3
05/22/2017 11:22 AM
Clockwork Tower (Specter)
Not fun
2 0
CoolBraden scotchy9008
05/22/2017 11:17 AM
Dirt Clod Dash
**** challenge mode for spector knight
2 0
Knight TeamKnight3
05/22/2017 10:51 AM
Pridemoor Keep (Specter)
1 0
Muertoloco chocolate010
05/21/2017 10:45 PM
The Lich Yard (Specter)
yeah
1 0
Mikey 123Vine3Loogoo
05/21/2017 6:48 PM
Village
2 0
Cheese JamesKnoxPolk
05/21/2017 6:45 PM
Clockwork Tower
1 0
jude judeCB
05/21/2017 5:59 PM
Tower of Fate: ???? (Specter)
BEST FINAL BOSS EVER!!! I LOVE SPECTER KNIGHT! MY FAVORITE CHARACTER!
1 0
jm667_YTU 834068
05/21/2017 5:37 PM
Explotatorium (Specter)
lol
1 0
max Maxwell10000
05/21/2017 5:12 PM
Plains
uggg
4 0
Nick spriro
05/21/2017 5:08 PM
Stranded Ship (Specter)
this is so hard
0 0
Vladimir Vladimir040200
05/21/2017 5:01 PM
Torre del Hado: ???? (Specter)
1 0
B33 libcall
05/21/2017 4:53 PM
Flying Machine
I keep losing. So close yet so far. This close to rage quitting.
1 0
Tammy SUPERWOW_75
05/21/2017 4:44 PM
Plains
1 0
megaman danz05
05/21/2017 4:00 PM
Plains
good game is shovle night
0 0
Anaya candycomet05
05/21/2017 3:41 PM
Tower of Fate (Specter)
Missy is cute
1 0
Nathan kharding15
05/21/2017 3:33 PM
Troupple Pond
the dance tho
1 0
undertale oswalda5
05/21/2017 2:51 PM
Plains (Plague)
1 0
undertale oswalda5
05/21/2017 2:49 PM
Plains (Plague)
>:(
0 0
undertale oswalda5
05/21/2017 2:47 PM
Plains (Plague)
:(
0 0
undertale oswalda5
05/21/2017 2:31 PM
Plains (Plague)
1 0
PUPPY Noahs.Ark24
05/21/2017 2:13 PM
Tower of Fate (Specter)
Well it doesn't seem like I'm beating Horace's tower anytime soon
0 0
Corey CBennet
05/21/2017 2:12 PM
Plains (Specter)
Nice Turtle Rino.
1 0
Ady adylpika
05/21/2017 2:05 PM
Plains
3 0
ccrraazzyy bt6sitb
05/21/2017 1:39 PM
The Lich Yard
im playing two player with two fairies using one ammibo.
1 0
Ady adylpika
05/21/2017 1:36 PM
Village
3 0
krazy kaos krazykaos2006
05/21/2017 1:28 PM
Pridemoor Keep
Somebody tell me what to do.
0 0
Dylan DSFreako
05/21/2017 1:07 PM
Flying Machine (Specter)
I never get sick of the Flying Machine music!
1 0
qwyxzvag qwyxzvag
05/21/2017 12:59 PM
The Lich Yard (Specter)
0 0
Papi aarnel
05/21/2017 11:43 AM
The Lich Yard
So hard!!
2 0
Blu BluTallulah
05/21/2017 11:41 AM
Lost City (Plague)
2 0
Improviser improviserPAT
05/21/2017 11:29 AM
Tower of Fate: ???? (Specter)
Was not expecting that!
0 0
Mr.Awesome ElJefe490
05/21/2017 11:19 AM
Pridemoor Keep (Plague)
awesomely amazing!!!!!!!!
1 0
Joshua Jman12505
05/21/2017 11:00 AM
Plains
Multiplayer with my sis, can't lie, it's harder
3 0
Jonathan JONYBIG13
05/21/2017 10:25 AM
Troupple Pond
2 0
Jacob zTehBeast
05/21/2017 9:58 AM
Pridemoor Keep
Ive killed this boss too many times 0.0
0 0
Jacob zTehBeast
05/21/2017 9:32 AM
Pridemoor Keep
Grinding for money isn't fun.
1 0
__GAMES__ gamingboy7
05/21/2017 9:05 AM
Pridemoor Keep
how do i beat lord/king kinght
0 0
__GAMES__ gamingboy7
05/21/2017 9:00 AM
Pridemoor Keep
king knight is so hard
1 0
michael IamDgr8one
05/21/2017 8:49 AM
Flying Machine
its awsome
5 3
Matt MattNJack
05/21/2017 8:47 AM
Tower of Fate (Specter)
how are you supposed to beat beetos big break xd ( Challenge mode )
2 0
__GAMES__ gamingboy7
05/21/2017 8:41 AM
Pridemoor Keep
I just got this game :0 LOVING IT im on my brothers acount
0 0
__GAMES__ gamingboy7
05/21/2017 8:36 AM
Pridemoor Keep
how to get past the book part
4 0
Harrison GreatSlayer73
05/21/2017 8:24 AM
Lost City (Specter)
How to design a game! Step1: Be Yacht Club Games. Step 2: You're done, good job
6 0
__GAMES__ gamingboy7
05/21/2017 8:22 AM
Plains
so fun
1 0
pedroUSA mewtwoPG
05/21/2017 8:13 AM
Torre do Destino: ???? (Specter)
acabei de derrotar o reize do capeta
0 0
Megmed qolgezus
05/21/2017 7:52 AM
The Lich Yard
I'm still mad that shovel knight isn't in smash. I'm still so mad
4 0
jacob mcarthurland
05/21/2017 7:40 AM
Tower of Fate: Ascent
fighting all of the order of no quarter
0 0
SkullCrshr SkullCrsher2007
05/21/2017 7:06 AM
Armor Outpost
that was akward
0 0
Anaya candycomet05
05/21/2017 5:44 AM
Iron Whale (Specter)
So NOW we're on the Iron Whale.
3 0
SkullCrshr SkullCrsher2007
05/21/2017 5:24 AM
Encounter - Black Knight
gg fool can't beat me!
1 0
Anaya candycomet05
05/21/2017 5:22 AM
Tower of Fate (Specter)
He kissed me... *Dies*
6 0
Blu BluTallulah
05/21/2017 5:03 AM
Village (Plague)
5 0
SkullCrshr SkullCrsher2007
05/21/2017 5:02 AM
Lost City
dust knuckles won't work...
0 0
SkullCrshr SkullCrsher2007
05/21/2017 4:11 AM
Explodatorium
0 0
SkullCrshr SkullCrsher2007
05/21/2017 4:01 AM
Encounter - Baz
Healing ichor is da key to victory oh and phase locket
2 0
Jarvis CalGoldenBear12
05/20/2017 10:38 PM
Troupple Pond
BEEPBEEP LETTUCE
3 0
anna,evan evandean2006
05/20/2017 10:22 PM
Armor Outpost
im live it i love it now i completed the game 100%
1 0
Asher AsherKid
05/20/2017 8:59 PM
Village
I just tarted though i am farther on the switch
2 0
JJ Tallfire2012
05/20/2017 8:46 PM
Village
when spectre knight is a swaglord :D
0 0
PetiteSol hermanos77
05/20/2017 8:40 PM
Plaines (Specter)
laruda
0 0
Henry GreenThunder909
05/20/2017 8:39 PM
Tower of Fate: Ascent
Polar Knight + New Game+ = LOTS AND LOTS OF DEATH!
3 0
Jeannie epicpokemaniac
05/20/2017 8:26 PM
Flying Machine (Specter)
Does anyone else absolutely adore that sunset, behind the window?
3 0
danny websymphony
05/20/2017 8:13 PM
Armor Outpost (Plague)
2 0
danny websymphony
05/20/2017 8:10 PM
Armor Outpost (Plague)
0 0
danny websymphony
05/20/2017 8:07 PM
Armor Outpost (Plague)
1 0
SkullCrshr SkullCrsher2007
05/20/2017 7:06 PM
Encounter - Baz
sooo much easier in plauge of shadows
2 0
SkullCrshr SkullCrsher2007
05/20/2017 7:02 PM
Encounter - Baz
1 0
SkullCrshr SkullCrsher2007
05/20/2017 6:55 PM
Encounter - Reize
REIZE DOWN!!!!!!!
0 0
SkullCrshr SkullCrsher2007
05/20/2017 6:48 PM
Iron Whale
TANGO DOWN I REPEAT TANGO DOWN!!!
1 0
SkullCrshr SkullCrsher2007
05/20/2017 6:46 PM
Iron Whale
geez stupid anchor gun!!!!!
0 0
Jacob zTehBeast
05/20/2017 6:27 PM
The Lich Yard
Phase Locket is my favorite relic so far
1 0
Danzig262 merlinkme262
05/20/2017 6:25 PM
Tower of Fate: ????
tower of fate? more like leaps of faith
4 0
Danzig262 merlinkme262
05/20/2017 6:21 PM
Village
go to the red guy and buy anything he has. then visit the truapple pond use a fishingrod and enjoy
0 0
SkullCrshr SkullCrsher2007
05/20/2017 6:11 PM
Village
spam much?
1 0
Henry GreenThunder909
05/20/2017 6:09 PM
Flying Machine
What a drama queen...
0 0
SkullCrshr SkullCrsher2007
05/20/2017 6:08 PM
The Lich Yard
oh ok i keep a meal ticket in a BRAND NEW Chest
0 0
SkullCrshr SkullCrsher2007
05/20/2017 6:06 PM
The Lich Yard
2nd try specter down!!!
0 0
Jacob zTehBeast
05/20/2017 6:05 PM
Village
I just beat Queen (King) Knight!
3 1
J.V :) bdog2015
05/20/2017 6:04 PM
Torre del Hado (Specter)
oooooro gustaaaaa caaaapa siiii
0 0
Danzig262 merlinkme262
05/20/2017 5:47 PM
Village
2 0
jesse jamguy1013
05/20/2017 5:28 PM
Plains (Specter)
just started specter of torment,
1 0
jude judeCB
05/20/2017 4:30 PM
Clockwork Tower
YAHOO! SPECTER KNIGHT FOR THE WIN!!!
1 0
jude judeCB
05/20/2017 4:25 PM
Clockwork Tower
TOO MANY SPIKES! AAAAAAHHHH!!!!
0 0
Alexander Alexster69
05/20/2017 3:53 PM
Tower of Fate (Specter)
This place needs a visit from the health inspecter
4 0
Squeaky Pandas4lyfe2
05/20/2017 3:49 PM
Village
Hello World!
2 0
Lil'Jim LilJim725
05/20/2017 3:20 PM
Tower of Fate (Specter)
God dang, i love specter of torment
3 0
jordannic jordannnic
05/20/2017 3:18 PM
Pridemoor Keep (Plague)
0 0
Keegan KeeganQR
05/20/2017 2:45 PM
Plains (Plague)
new game plus!
0 0
Jacob zTehBeast
05/20/2017 2:13 PM
Plains
rip forty dollars
0 0
Arcoxx ArcoXD
05/20/2017 2:12 PM
Torre del Hado (Specter)
fgfrgrtudrtgffyuyygrydsfd
0 0
Arcoxx ArcoXD
05/20/2017 2:11 PM
Torre del Hado (Specter)
estas vien
1 0
Arcoxx ArcoXD
05/20/2017 2:10 PM
Torre del Hado (Specter)
adonde estas
0 0
Cam traydfull
05/20/2017 2:08 PM
Hall of Champions
Boss Fight
0 0
jaxen black.kat.013
05/20/2017 2:07 PM
Clockwork Tower
oh, wow easy stuff. (after) OH NO HE HAS A BIG MACHINE
2 0
Jamey Beezojuju
05/20/2017 2:00 PM
Plains (Plague)
#oolong=life
5 0
Mr.Happy Jokerforlife2001
05/20/2017 1:53 PM
Tower of Fate: Entrance
Shovel Knight
4 0
Will will110407
05/20/2017 1:14 PM
The Lich Yard (Plague)
my profile represents me now
3 0
Kasey Descant
05/20/2017 12:55 PM
The Lich Yard
Just gravediggin'. ;)
2 0
isaac omgods
05/20/2017 11:30 AM
Tower of Fate (Specter)
what have i done?
2 0
isaac omgods
05/20/2017 11:28 AM
Tower of Fate (Specter)
rail mail is great in the explodeatoreum
1 0
Danny dannytataje
05/20/2017 11:07 AM
Clockwork Tower (Specter)
DAMN SON
2 0
ramen TriforceLord
05/20/2017 11:04 AM
Tower of Fate (Specter)
3 0
Henry GreenThunder909
05/20/2017 10:42 AM
Flying Machine
If you're looking for something musical, you might want to search extra hard here.
1 0
raulito jared_nico
05/20/2017 10:17 AM
Campiña
lol mi amigo no sabe jugar
4 0
Henry GreenThunder909
05/20/2017 10:06 AM
Flying Machine
Thank you, kind propeller fellow! It's acts like these that me feel so happy!
0 0
Henry GreenThunder909
05/20/2017 9:59 AM
Flying Machine
If you're having trouble with these guys, try giving them a taste of their own medicine.
0 0
Henry GreenThunder909
05/20/2017 9:40 AM
Flying Machine
This music tho
0 0
numnum numnum904
05/20/2017 9:01 AM
Plains (Plague)
1 0
Henry GreenThunder909
05/20/2017 9:00 AM
Encounter - Phantom Striker
Ichor of Boldness helps a lot!
4 0
Henry GreenThunder909
05/20/2017 8:35 AM
Clockwork Tower
They're like tall Tinker Knights!
1 0
specter. Clawman2000
05/20/2017 8:31 AM
Pridemoor Keep (Specter)
This is, what? Probably my 15th playthrough of Specter of Torment? Love this game so much!
0 0
Tobella Toby11704
05/20/2017 7:47 AM
Village
2 0
Ginger HordeOfBoys
05/20/2017 7:41 AM
Clockwork Tower (Specter)
0 0
isaac omgods
05/20/2017 7:40 AM
Plains (Specter)
have megaman x mode active.
1 0
linkgamer jaynoahh
05/20/2017 5:52 AM
Tower of Fate (Specter)
2 0
midnight shadowperson17
05/19/2017 9:15 PM
Tower of Fate: Entrance (Plague)
2 0
midnight shadowperson17
05/19/2017 9:12 PM
Tower of Fate: Entrance (Plague)
bombs glore it blazing. just gotta dodge fast
2 0
Jarvis CalGoldenBear12
05/19/2017 8:17 PM
Iron Whale
3 0
DMIA MiaMacMac
05/19/2017 8:08 PM
Tower of Fate (Specter)
4 0
Jarvis CalGoldenBear12
05/19/2017 8:06 PM
Iron Whale
2 0
Jamey Beezojuju
05/19/2017 7:17 PM
Tower of Fate (Specter)
i want shield kni
2 0
Tatara Tara-bug
05/19/2017 6:23 PM
Flying Machine
I dearly dislike Propeller Knight in Shovel of hope.
0 0
xmassTJ suzyque82
05/19/2017 6:07 PM
Village (Plague)
i finish all of the quest now im doing all of them all over when kingknight is out yes!
4 0
Henry GreenThunder909
05/19/2017 6:07 PM
Hall of Champions
What a great way to thank the supporters of this game!
0 0
Devon Metallix1135
05/19/2017 5:16 PM
Tower of Fate (Specter)
Looks like Specter Knight could use some OLD SPICE DOUBLE SUN POWEEEEEEEER!!!!
9 0
Reid Soggyguy
05/19/2017 3:33 PM
Stranded Ship (Specter)
what is with this room help
0 0
Tona:3 TonaGamerPro
05/19/2017 2:51 PM
Campiña (Specter)
1 0
Júlio Ultimateplayg
05/19/2017 2:20 PM
Village
bodyswamp is neat because it respects women in 2017
0 0
Joey joeyButtons
05/19/2017 1:53 PM
Pridemoor Keep
HOW DO YOU BEAT PRIDEMOOR KEEP?!?!
0 0
SkullCrshr SkullCrsher2007
05/19/2017 1:18 PM
Iron Whale (Plague)
treasure knight down
0 0
Jamey Beezojuju
05/19/2017 1:04 PM
Flying Machine (Specter)
what does the amibo do in shovel knight
1 0
SkullCrshr SkullCrsher2007
05/19/2017 12:36 PM
The Lich Yard (Plague)
Wow specter is rlly ez with bomb lob casing!!!
1 0
hard haroldpaz32
05/19/2017 11:51 AM
Villa
lla casi lo termino todo el juego
0 0
hard haroldpaz32
05/19/2017 10:58 AM
Mansión de los Campeones
easy
0 0
Alan Rasganort
05/19/2017 10:41 AM
Tower of Fate (Specter)
6 0
cam yahnaw
05/19/2017 2:19 AM
Plains
how do you beat black kight
0 0
Jarvis CalGoldenBear12
05/18/2017 9:50 PM
Troupple Pond
0 0
Emmy KonataKitty
05/18/2017 9:12 PM
Pridemoor Keep
0 0
Emmy KonataKitty
05/18/2017 9:08 PM
Pridemoor Keep
o dang son killed u a second time heckin dingus git gud
0 0
dr.elmo jakedadmom
05/18/2017 6:30 PM
Flying Machine
i keep losing my money
1 0
gaelin GAELIN10
05/18/2017 6:25 PM
Torre del Hado (Specter)
2 0
SkullCrshr SkullCrsher2007
05/18/2017 5:54 PM
The Lich Yard (Plague)
i have a I H@TE relationship with specter knight
0 0
Dewbee D3WB33
05/18/2017 5:53 PM
Tower of Fate (Specter)
5 0
SkullCrshr SkullCrsher2007
05/18/2017 5:47 PM
The Lich Yard (Plague)
I HATE YOU SPECTOR
0 0
drew Mega-Eevee7
05/18/2017 5:26 PM
Tower of Fate (Specter)
hi guys who wants more playable caraters cause i do
11 0
Evan EvanHosea
05/18/2017 5:10 PM
Tower of Fate: ???? (Plague)
Ratcopter!?
0 0
Aidan aidan_doyle
05/18/2017 5:04 PM
Flying Machine (Specter)
Okey dokey...
0 0
Aidan aidan_doyle
05/18/2017 5:03 PM
Flying Machine (Specter)
I agree with Jack
0 1
Aidan aidan_doyle
05/18/2017 4:51 PM
Flying Machine (Specter)
I have seen some crazy $h*%, but flying cabage babies goes beyondanythingI have seen before.
6 0
Jason jasonmg99
05/18/2017 4:20 PM
Plains (Specter)
I am Zazzaro! The Spector of Torment!
1 0
jj jacob202
05/18/2017 3:13 PM
Tower of Fate: ???? (Specter)
i hate this fight
1 0
sebastian justricky
05/18/2017 1:43 PM
Pridemoor Keep (Specter)
1 0
Missy Missyolg
05/18/2017 11:21 AM
The Lich Yard
0 0
Missy Missyolg
05/18/2017 11:08 AM
The Lich Yard
0 0
Missy Missyolg
05/18/2017 10:48 AM
Pridemoor Keep
0 0
Brenden brenmac8
05/18/2017 10:30 AM
Tower of Fate (Specter)
tbh the way new game plus makes it harder, not spoiling how tho, is very fitting bc the undead theme
4 0
Starret Keyotea
05/18/2017 9:09 AM
Clockwork Tower
Beat the crazy clock.
2 0
chiquinho detonausa
05/17/2017 8:27 PM
Torre do destino (Specter)
o cavaleiro dá pá e cavaleiro specter tem no nintendo switch wii u e 3ds pessoal do miiverse
3 0
chiquinho detonausa
05/17/2017 8:26 PM
Torre do destino (Specter)
eu derrotei o cavaleiro tinker e o cavaleiro polar com cavaleiro specter pessoal do miiverse
3 0
Dav13gamer Dav13gamer
05/17/2017 7:52 PM
Torre del Hado: Entrada (Specter)
alguien vivo en esta comunidad?
2 1
Darren DQ_302
05/17/2017 6:56 PM
Tower of Fate: ???? (Plague)
why is the final fight for plague knight so hard
1 0
jase margobirdwell
05/17/2017 6:39 PM
Explodatorium
ughh tryingto beat pleage doc.........
6 0
jase margobirdwell
05/17/2017 6:37 PM
Explodatorium
3 0
Blu BluTallulah
05/17/2017 6:22 PM
Tower of Fate: Entrance
3 0
Blu BluTallulah
05/17/2017 6:14 PM
Tower of Fate: Entrance
4 0
Arcaderboy ArcadeRX
05/17/2017 5:46 PM
Lost City
life is cruel me friends :3
1 0
link pman1214
05/17/2017 2:31 PM
The Lich Yard
0 0
diego Diegohkey
05/17/2017 1:28 PM
Fortaleza del Orgullo (Plague)
sdxttfutfdsfffffyhsdaffF b ft
0 0
diego Diegohkey
05/17/2017 12:41 PM
Campiña (Plague)
fdhe
0 0
colton link21104
05/17/2017 11:03 AM
Pridemoor Keep
revenge for the king
0 0
Erika witesh
05/17/2017 9:46 AM
The Lich Yard
hidden buried treasure in the top left of the screen.
3 0
DanDLion DanDLionRO
05/17/2017 9:19 AM
Tower of Fate: Entrance
7 0
Alia AkkoKagari
05/17/2017 3:57 AM
Clockwork Tower
I am jealous of Player 2's armour set.
13 1
Erika witesh
05/16/2017 9:02 PM
Pridemoor Keep
don't eat the candy! it's poison
1 1
King Boss Jack_Master_Grab
05/16/2017 8:32 PM
Stranded Ship (Specter)
Canada Knight is my fav.
3 0
chiquinho detonausa
05/16/2017 7:40 PM
A Cidade Perdida (Specter)
eu derrotei o cavaleiro mole com o cavaleiro specter pessoal do miiverse ϋ
1 0
DMIA MiaMacMac
05/16/2017 7:31 PM
Village
0 0
Blu BluTallulah
05/16/2017 6:35 PM
Flying Machine
3 0
Blu BluTallulah
05/16/2017 6:27 PM
Flying Machine
1 0
Nicholas Jacksepticeye239
05/16/2017 6:25 PM
Tower of Fate (Specter)
I got so close then died
2 0
Nick AlbinoLucario
05/16/2017 5:58 PM
Tower of Fate (Specter)
My advice: upgraded judgement rush + rail mail = victory...possibly
5 0
JAV javrivera
05/16/2017 5:32 PM
Tower of Fate (Specter)
Still looking for all the red skulls.
7 1
Blu BluTallulah
05/16/2017 5:17 PM
Encounter - Phantom Striker
3 0
Blu BluTallulah
05/16/2017 5:02 PM
Clockwork Tower
0 0
SkullCrshr SkullCrsher2007
05/16/2017 4:55 PM
Tower of Fate (Specter)
You fight phantom striker instead :l
5 0
LeDummKlum klumsykraft
05/16/2017 4:51 PM
Plains (Specter)
THIS GAME IS SO... COOL!!!!
4 0
Blu BluTallulah
05/16/2017 4:49 PM
Clockwork Tower
0 0
TerahGrump rascatropelus
05/16/2017 4:46 PM
Plains (Plague)
I have gotten so mad at this game!
2 0
Joshua Jman12505
05/16/2017 4:31 PM
Pridemoor Keep (Plague)
5 0
jp jplec0501
05/16/2017 4:23 PM
Plains (Specter)
donovan = specter knight
5 0
Cheesecurd slipperyfisch87
05/16/2017 4:13 PM
Tower of Fate (Specter)
Anyone want to fight alongside me?! THIS IS AWESOME!!!!
8 1
TerahGrump rascatropelus
05/16/2017 3:24 PM
Pridemoor Keep (Specter)
I love the secret room in king knights level
3 0
chara preston0506
05/16/2017 2:42 PM
Grave Robber
first try
0 0
DMIA MiaMacMac
05/16/2017 1:41 AM
Tower of Fate (Specter)
1 0
DMIA MiaMacMac
05/16/2017 1:32 AM
Tower of Fate (Specter)
4 0
Popee SaltyShoryuken
05/15/2017 8:33 PM
Iron Whale
git gud
3 0
cory smashfan2003
05/15/2017 8:02 PM
Lost City
well then
0 0
Wes SillySilva96
05/15/2017 7:33 PM
Pridemoor Keep (Plague)
just got the dlc stories, plague knight plays quite differently than shovel night
1 0
Jax Jax321
05/15/2017 5:41 PM
Village
weres the armorer and the shovel smith
2 0
Ultralord GalactaKnight
05/15/2017 4:57 PM
Lost City
Why is goo bouncing so addicting?
2 0
****** Digipengiun2
05/15/2017 3:44 PM
Plains (Specter)
Noice.
0 0
Joshua T. Joshe13
05/15/2017 3:36 PM
Tower of Fate: ???? (Specter)
no boss rush :(
3 0
Darren DQ_302
05/15/2017 3:13 PM
Tower of Fate: Ascent
This game is even more fun in new game + mode
1 0
JOLLY JEFF Monsteratior
05/15/2017 2:59 PM
Flying Machine
Tip on those green guys. When you see one, stop. Wait until they come closer, then strike!
1 0
diane 2 msucraw
05/15/2017 2:57 PM
Stranded Ship (Specter)
when the stalagmites drop from the ceiling climb on them and wail on him from above
0 0
diane 2 msucraw
05/15/2017 2:50 PM
The Lich Yard (Specter)
not as hard as the first two fights but he has alot of added attacks
2 0
JOLLY JEFF Monsteratior
05/15/2017 2:40 PM
Armor Outpost
You can fish at that hole there. You dont really get much but its funy geting stuff from the streets
1 0
Seamus seamus215
05/15/2017 1:46 PM
The Lich Yard
HERE COME DAT TAP HERE TO ADD TEXT
2 0
Seamus seamus215
05/15/2017 1:37 PM
Pridemoor Keep
HERE COME DAT POTION
0 0
James Jamesmip
05/15/2017 12:19 PM
Plains (Specter)
bjyu
1 0
DanDLion DanDLionRO
05/15/2017 10:08 AM
Encounter - Black Knight
3 0
ben cappsboys2011
05/14/2017 7:35 PM
Clockwork Tower (Specter)
love the spector of torment dlc so far
2 1
Riley eliteprime
05/14/2017 7:16 PM
Tower of Fate (Specter)
I wonder if you fight shovel knight as specter knight
4 2
Emmy KonataKitty
05/14/2017 6:40 PM
Pridemoor Keep
effin dingus goomba like mother effer ... itz gud
1 0
Venomous VenomousFox
05/14/2017 5:47 PM
The Lich Yard
LOL taking me so long to beat it got him down to 3 hp
3 0
inklingboy EmilianoHuato
05/14/2017 5:34 PM
Fortaleza del Orgullo
0 0
Galax 7777 Galax7777
05/14/2017 4:21 PM
Torre Mecánica
0 0
Daddy Stlcoltsfan
05/14/2017 4:12 PM
Iron Whale
hi
1 0
Trevor FreddyFazbear90
05/14/2017 2:40 PM
Tower of Fate (Specter)
3 1
Andres supergamer1225
05/14/2017 1:04 PM
Grave Robber
first
0 0
Ethan EthanSamK
05/14/2017 12:28 PM
Tower of Fate (Specter)
I will beat you yet, Horace!
0 0
Bradly Bradly360
05/14/2017 12:21 PM
Iron Whale (Plague)
awesome
0 0
Googeyz GoogeGamez
05/14/2017 12:12 PM
Explodatorium (Plague)
Plague Knight Looks Much Better In Plauge of Shadows!
0 0
Bz Chainz bzrzoss
05/14/2017 11:15 AM
Pridemoor Keep
3 0
kain 134646
05/14/2017 10:34 AM
Pridemoor Keep
king knight is a heccin dingus
1 0
Sophie TankGirlLives
05/14/2017 10:10 AM
Flying Machine (Specter)
i am a man let's go on skateborads!
1 0
isaac omgods
05/14/2017 9:27 AM
Pridemoor Keep (Specter)
and everything fell in the holes
1 0
Colemine link2004island
05/14/2017 7:50 AM
Tower of Fate: ???? (Specter)
JUST DIE ALREADY!
1 0
Connor crmanley06
05/14/2017 7:05 AM
Lost City (Specter)
Good luck fellow spectors
0 0
Aubbie kaisersecare
05/14/2017 6:08 AM
Plains
1 0
SkullCrshr SkullCrsher2007
05/14/2017 4:02 AM
Flying Machine (Specter)
I love spector knight playthrough
2 0
Joe JoeMA512
05/14/2017 12:37 AM
The Lich Yard (Plague)
1 0
JfWood catocat9001
05/13/2017 7:38 PM
Tower of Fate (Specter)
2 0
Gustavo Gusval
05/13/2017 6:13 PM
Village (Plague)
Por fin tengo todos los feats de Shovel knight!¡¡¡ Ahora por los de Plage knight
0 0
BANANA gophergoggle
05/13/2017 5:58 PM
Armor Outpost
why can't I jump on the trampoline??????????????????????????????????????????????????????????????????
1 0
BANANA gophergoggle
05/13/2017 5:38 PM
Village
hwaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa!!!!!!!!!!!!!!!!!!!!!!
1 0
BANANA gophergoggle
05/13/2017 5:36 PM
Village
0 0
BANANA gophergoggle
05/13/2017 5:32 PM
Village
1 0
BANANA gophergoggle
05/13/2017 5:24 PM
Village
0 0
Mommy Amy amyskidsplace
05/13/2017 5:22 PM
Tower of Fate (Specter)
i died by the kiss of death
2 0
BANANA gophergoggle
05/13/2017 5:18 PM
Village
0 0
BANANA gophergoggle
05/13/2017 5:15 PM
Village
the superrrrr.................boogerman!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
0 0
BANANA gophergoggle
05/13/2017 5:07 PM
Village
lady sheild shovel guiatar key
0 0
Daddy Stlcoltsfan
05/13/2017 5:01 PM
Lost City
plauge knight
0 0
BANANA gophergoggle
05/13/2017 5:01 PM
Village
wow u scawy
0 0
BANANA gophergoggle
05/13/2017 4:59 PM
Village
Its not a stick!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
0 0
BANANA gophergoggle
05/13/2017 4:47 PM
Village
4 0
BANANA gophergoggle
05/13/2017 4:46 PM
Village
0 0
BANANA gophergoggle
05/13/2017 4:44 PM
Village
0 0
BANANA gophergoggle
05/13/2017 4:40 PM
Village
1 0
kam Kamlola
05/13/2017 2:56 PM
Tower of Fate (Specter)
i m Done I WIN!!!!!!!!!!!!!!!!!!!!
0 0
Ray Coon slt750
05/13/2017 2:43 PM
The Lich Yard (Plague)
this game is amazing
0 0
h marioluigisonic
05/13/2017 2:05 PM
Encounter - Baz
baz is easy
2 0
h marioluigisonic
05/13/2017 1:38 PM
Pridemoor Keep
so f'in ezy
0 0
h marioluigisonic
05/13/2017 1:31 PM
Pridemoor Keep
I cant wait for king knight to be playable
5 0
Ross panda292001
05/13/2017 12:09 PM
Tower of Fate (Specter)
yeah i'm Edgy
1 0
jayden.uno vjunony
05/13/2017 12:07 PM
Plains
,vnmhvkxjdvcg
3 1
Jack exitinyourhead
05/13/2017 11:40 AM
Tower of Fate: ???? (Specter)
where are the red skulls?
0 1
Jack exitinyourhead
05/13/2017 11:28 AM
Tower of Fate: Entrance (Specter)
the donovan armor isn't worth this
1 0
Jack exitinyourhead
05/13/2017 11:22 AM
Tower of Fate: Entrance (Specter)
this game is like eggnog. you get the impression most people like it. but everyone says they hateit.
2 0
Xander107 ZANTTT
05/13/2017 10:33 AM
Tower of Fate (Specter)
Spent hours doing Horace's minigame, and wasted all my money afterwards.
3 0
Connor crmanley06
05/13/2017 9:09 AM
Plains
took a sec to beat black night
3 0
Brayan kirbygamerlink
05/13/2017 9:06 AM
Torre Mecánica (Specter)
K Dicifil
0 0
Aidan arsenicaidan
05/13/2017 8:22 AM
Plains (Plague)
0 0
dude rosenbhh
05/13/2017 8:11 AM
Lost City
Flaming Hair for female Mole Knight. Nice touch
2 0
SkullCrshr SkullCrsher2007
05/13/2017 8:08 AM
Stranded Ship (Specter)
OMG second boss polar knight ded
1 0
cj charles904
05/13/2017 7:54 AM
Stranded Ship (Specter)
what an evil dude
1 0
Jack exitinyourhead
05/13/2017 7:54 AM
Pridemoor Keep (Specter)
i just destroyed every savepoint. didnt die the whole level. then fell in a hole in the boss fight.
7 1
snibbets snibbets101
05/13/2017 7:08 AM
Tower of Fate (Specter)
whats your fav person to play as?
5 1
Boon DKingdomCrusher
05/13/2017 6:16 AM
Tower of Fate (Specter)
Ha ha, your right. you can pet it.
2 1
mm2wood VerbalGenius
05/12/2017 9:38 PM
Armor Outpost
Y'know what, this game's pretty cool!
2 0
Daniel DanielMcnugget12
05/12/2017 6:25 PM
Troupple Pond
ALL HAIL THE TROUPLE KING AND HIS DRINKABLE SALIVA!!!
4 0
Daniel DanielMcnugget12
05/12/2017 6:23 PM
Lost City
1 0
Daniel DanielMcnugget12
05/12/2017 6:02 PM
Hall of Champions
0 0
martinazon martinazon88
05/12/2017 5:18 PM
Finca de Liches
oooooo
0 0
Lennon lenbomb06
05/12/2017 5:04 PM
Tower of Fate (Specter)
1 0
tacoman tacoman324
05/12/2017 4:50 PM
Clockwork Tower (Specter)
2 0
sarabella leavellheaded
05/12/2017 4:22 PM
Explodatorium (Plague)
that guy is on our side so why is he attacking us
1 0
Javier GoronBrother64
05/12/2017 3:56 PM
The Lich Yard (Plague)
That underground coin area was such a pain
2 0
Thomas snakethegreat
05/12/2017 3:35 PM
Plains
i eat arse
0 0
samson samson1321
05/12/2017 1:46 PM
Pridemoor Keep (Specter)
0 0
Missy Missyolg
05/12/2017 1:36 PM
Plains
0 0
Clay Claypup
05/12/2017 1:13 PM
Pridemoor Keep (Plague)
"Bombs? Rope? You want it? It's yours, my friend! Just as long as you have enough rubies!" -Morshu
1 0
Clay Claypup
05/12/2017 12:16 PM
Plains (Specter)
If you have your name on the save file as Booty, it's kind of funny when you get defeated.
1 0
Telly TeaWest
05/12/2017 6:10 AM
Village
This game rulez. I "dig" it :D... sorry for the bad joke
5 0
Nicholas nicholas4alex
05/12/2017 4:49 AM
Plains
hard
0 1
chiquinho detonausa
05/11/2017 7:41 PM
Torre do Destino: Entrada
0 0
chiquinho detonausa
05/11/2017 7:28 PM
Torre do Destino: Entrada
esse castelo lembra o jogo do megadrive xbox 360 e celular o castelo da ilusão com mickey mouse
0 0
Poké Aiden SamieLink
05/11/2017 5:10 PM
Village
What is body swap mode?
1 0
Draisien chronophobia42
05/11/2017 5:09 PM
Plains (Specter)
1 0
Poké Aiden SamieLink
05/11/2017 5:00 PM
Plains
Hello Im playing shovel knight with my friend:)
2 0
cooper speedycooper
05/11/2017 4:58 PM
Lost City
mole knight rekt 2nd try!
0 0
Levy XcaptianLEVyX
05/11/2017 4:02 PM
Pridemoor Keep (Plague)
t
0 0
Tobella Toby11704
05/11/2017 3:23 PM
Tower of Fate (Specter)
4 0
Moe djbowers319
05/11/2017 2:54 PM
Tower of Fate: Entrance (Specter)
I had 15000 going into this level and after the jelly section, i have 570
1 0
shamwow cactus_family_41
05/11/2017 2:54 PM
The Lich Yard
If you use a fishing rod on the treasure you lose when you die you can pick it up
4 0
Thomas snakethegreat
05/11/2017 2:51 PM
Encounter - Baz
Im playing this game for the first time im three hours in.I LOVE IT!
1 0
Gabe Gabestack
05/11/2017 2:18 PM
Hall of Champions (Plague)
iM A GRUMP, anD IM NOT SO GRUMP, and we're the gaME GRUMPS
2 0
dswig djswig
05/11/2017 1:51 PM
Tower of Fate (Specter)
i suggest using the judgement rush
2 0
dswig djswig
05/11/2017 1:46 PM
Tower of Fate (Specter)
i got all the red skulls!!!
2 0
sapo martires17
05/11/2017 1:32 PM
Máquina Voladora
jodanse
0 0
Connor Webwise
05/11/2017 12:16 PM
The Lich Yard
speeeeeeeeteeeerrrrrrr butt
1 0
alex notanonmously
05/11/2017 9:13 AM
Village (Plague)
bluh
1 0
alex notanonmously
05/11/2017 9:12 AM
Plains (Plague)
1 0
chiquinho detonausa
05/10/2017 7:52 PM
Torre do Destino: Entrada
o meu shovel knight ou cavaleiro dá pá é mídia física pessoal do miiverse ok
2 0
nick quote64
05/10/2017 7:49 PM
Hall of Champions (Plague)
i hate this plade
0 0
chiquinho detonausa
05/10/2017 7:41 PM
Torre do Destino: Entrada
esse castelo fica chovendo do lado de fora do castelo pessoal do miiverse
0 0
chiquinho detonausa
05/10/2017 7:40 PM
Torre do Destino: Entrada
eu tô na torre do destino pessoal do miiverse
0 0
chiquinho detonausa
05/10/2017 7:29 PM
Máquina Voadora
sim eu derrotei o cavaleiro propeller alemão
0 0
chiquinho detonausa
05/10/2017 7:26 PM
Máquina Voadora
oh chefão apelão e muito chato
0 0
chiquinho detonausa
05/10/2017 7:26 PM
Máquina Voadora
eu tô morrendo direto com o cavaleiro alemão propeller
0 0
pokebro604 pokebro604
05/10/2017 7:15 PM
Pridemoor Keep
this game is so hard but it is also so addicting
1 0
Kiko kiko929
05/10/2017 6:11 PM
Plains
7 0
FoxehGK★ MrFoxehGK
05/10/2017 5:35 PM
Tower of Fate (Specter)
piece of cake
2 0
juliane Julianeithor
05/10/2017 3:08 PM
Charca Truchanzana
rayos es mas dificil en dos jugadores
6 0
Daniel DanielMcnugget12
05/10/2017 3:04 PM
Plains
i've had this game for two weeks and i've already beat it which proves I have no life
2 0
CrayA LordLeinad
05/10/2017 2:39 PM
The Lich Yard
4 0
chiquinho detonausa
05/09/2017 7:59 PM
Torre do Relógio
é um melhores jogos do estúdio yacht club games não é pessoal do miiverse
0 0
chiquinho detonausa
05/09/2017 7:58 PM
Torre do Relógio
esse jogo é muito bom mesmo eu também morri varias vezes
0 0
chiquinho detonausa
05/09/2017 7:49 PM
Torre do Relógio
eu derrotei o guerreiro fantasma o cenário é show tá de manhã fica de tarde e de noite
0 0
René Rene-DX
05/09/2017 6:55 PM
Campiña
1 0
ISA Isaema
05/09/2017 6:20 PM
Village
ok
1 0
Zero sonicd
05/09/2017 5:25 PM
Plains
Yes i defeated Black Knight!
1 0
Spencer spencyrou
05/09/2017 5:23 PM
The Lich Yard
Half a heart in a run with my sister, thanks phase locket!
0 0
elirock101 elirock1010
05/09/2017 3:56 PM
Clockwork Tower
yo baron set looking good
4 0
camster theshadow59
05/09/2017 3:14 PM
Tower of Fate (Specter)
FINALLY! I would for sure recommend the upgraded coin and grind suit.
0 0
maxcool123 macsimilinyoutub
05/09/2017 1:27 PM
Plaines
nice ce jeu
1 0
Genis GenisT8SB
05/09/2017 1:21 PM
Tower of Fate (Specter)
The Goldarmor's are really Dragons!
7 0
M tdg228
05/09/2017 10:53 AM
Iron Whale
2 0
Eric ejweinstein5
05/09/2017 4:51 AM
Village
This game is amazing!
0 0
Eric ejweinstein5
05/09/2017 4:50 AM
Village
boop it y bop y
1 0
Claire Princess365
05/08/2017 6:36 PM
Plains (Plague)
this is hard
3 0
inklingboy EmilianoHuato
05/08/2017 6:21 PM
Campiña
1 0
inklingboy EmilianoHuato
05/08/2017 6:19 PM
Campiña
0 0
Nicolas cachorra77
05/08/2017 5:12 PM
Tower of Fate: Entrance
Shovel knight: oh look, its that black knight. [a few seconds later] OH MY F***ING GOD!
3 0
Cooper S Willythewaffle
05/08/2017 4:57 PM
Encounter - Baz (Plague)
What is Baz anyway
0 0
Xander octoshark88
05/08/2017 4:32 PM
Tower of Fate (Specter)
3 0
shamwow cactus_family_41
05/08/2017 3:31 PM
Village (Plague)
PERCY ON THE DECK! WOOOOOO!
6 0
shamwow cactus_family_41
05/08/2017 3:27 PM
Stranded Ship (Plague)
That boss was so hard, yet I still beat him first try!
0 0
Fawful Tbone-bomber
05/08/2017 3:24 PM
Tower of Fate (Specter)
I'm death
3 0
thiago nomazanj
05/08/2017 3:07 PM
Torre del Hado (Specter)
que juegaso
6 0
luis Luis6438
05/08/2017 2:38 PM
Explotatorium
0 0
Austin Link.MLG
05/08/2017 2:29 PM
Rematch: The Big Creep
Wow Super Mario 64 got a reboot!
0 0
chiquinho detonausa
05/08/2017 1:54 PM
Anteposto de armaduras
ontem eu derrotei quatro cavaleiros no jogo shovel knight = cavaleiro dá pá de nintendo wii u
2 0
James Jamesmip
05/08/2017 1:30 PM
The Lich Yard
yay
0 0
liam maxx920
05/08/2017 1:18 PM
Plains
i always play whth my sister. But she dosent know how to play.
0 0
Payton BlueMLink
05/08/2017 12:34 PM
Tower of Fate: ????
yay
3 0
Jacob 0706jacob
05/08/2017 5:55 AM
Plains (Plague)
what is this, bomberman?
5 0
Hollis HOLLIS2003
05/07/2017 8:27 PM
Pridemoor Keep
dis game fun
0 0
chiquinho detonausa
05/07/2017 7:31 PM
A Cidade Perdida
e pra quem curte o shovel knight ou cavaleiro dá pá lembra dos jogos do castlevânia e megamam
2 0
chiquinho detonausa
05/07/2017 7:29 PM
A Cidade Perdida
alguém estiver jogando uma das três histórias do shovel knight = cavaleiro dá pá de nintendo wii u
0 0
chiquinho detonausa
05/07/2017 7:28 PM
A Cidade Perdida
aqui é o cavaleiro dá pá ou shovel knight e quem estiver jogando com algum das três histórias
1 0
Star star64
05/07/2017 7:13 PM
Tower of Fate (Specter)
EDGE
7 0
Gabriel snakeattack7
05/07/2017 7:07 PM
Clockwork Tower (Specter)
1 0
Angel angelthefirst-06
05/07/2017 6:44 PM
Tower of Fate (Specter)
h
2 0
Moises Gumba007
05/07/2017 6:39 PM
Pridemoor Keep
use the flying rodents at the end to reach the higher ground
2 0
camu camu camucamu2015
05/07/2017 6:35 PM
Tower of Fate (Specter)
This game is so hard!, but so much fun!!!!!!!! HAHA!
3 0
Moises Gumba007
05/07/2017 6:31 PM
Pridemoor Keep
last wall on the left has treasurer
0 0
TheMKnight darkmario777
05/07/2017 4:45 PM
Tower of Fate (Specter)
The Edge Farmer loves Cold Shoulders... and the Rail Mail.
3 0
Phanton PanthonMess
05/07/2017 4:41 PM
Lost City (Specter)
hell ye
1 0
Mr.? Fenfir
05/07/2017 4:18 PM
Plains (Specter)
bird is the word
2 0
Clementine Oshawott82
05/07/2017 4:09 PM
Village
;)
0 0
Blu BluTallulah
05/07/2017 4:06 PM
Stranded Ship
10 0
SUPER BEN stjoeleo
05/07/2017 4:02 PM
Flying Machine
mario vibes anyone?
0 1
Blu BluTallulah
05/07/2017 3:58 PM
Stranded Ship
0 0
Got Ink? jediger
05/07/2017 3:57 PM
Tower of Fate (Specter)
Man the tower challenge was HARD!
0 0
Zetiraum zetiraum
05/07/2017 3:56 PM
A Cidade Perdida
0 0
Henry GremillionFamily
05/07/2017 3:31 PM
Tower of Fate (Specter)
this game › your favorite game
4 0
Roger rogerf1025
05/07/2017 2:54 PM
Tower of Fate (Specter)
holding down near the cat will let you pet it
3 0
SUPER BEN stjoeleo
05/07/2017 2:28 PM
Stranded Ship
who is your favorite boss mine is black knight
1 0
Tyler tjk1027
05/07/2017 1:51 PM
Plains
I just started, any beginner tips?
1 1
Aleah JackDuCoeur
05/07/2017 1:44 PM
Plains
neato
1 0
pedroUSA mewtwoPG
05/07/2017 1:02 PM
Planícies
Seus otaku fididu
0 0
Izerz05 Izerz05
05/07/2017 12:39 PM
Tower of Fate: Entrance (Specter)
cya terrorpin
1 0
Uriel alucardadriel
05/07/2017 12:30 PM
Campiña (Specter)
e ganado
1 0
CC andersonadonis
05/07/2017 12:29 PM
Tower of Fate: Entrance (Specter)
Go on Donovan, reclaim your life from Shield Kni-- I mean, the Enchantress..
1 0
Uriel alucardadriel
05/07/2017 12:28 PM
Campiña (Specter)
parese bowser conbinado con un riniseronte
3 0
isaac Bobcat0605
05/07/2017 12:19 PM
Plains (Specter)
I BOOTED UP SHOVEL KNIGHT AND NOW I HAVE TWO MORE EXTRA GAMES OMG Ö
4 0
Uriel alucardadriel
05/07/2017 12:14 PM
Campiña (Specter)
LOL
2 0
Mj FamousMj
05/07/2017 12:11 PM
Explodatorium
PACK A PUNCH BOSS
2 0
Mj FamousMj
05/07/2017 12:05 PM
Explodatorium
0 0
Mj FamousMj
05/07/2017 12:01 PM
Explodatorium
0 0
joshua 19speedpokey
05/07/2017 11:49 AM
Troupple Pond
ALL HAIL THE TROUPLE KING
4 0
Mj FamousMj
05/07/2017 11:44 AM
Iron Whale
0 0
joshua 19speedpokey
05/07/2017 11:42 AM
Plains
Doing a amiibo run! Just beat the first boss!
3 0
JfWood catocat9001
05/07/2017 11:41 AM
Pridemoor Keep
type a code in its stqqtxvx
0 0
Mj FamousMj
05/07/2017 11:15 AM
The Lich Yard
phantom + knight = specter knight
1 0
Mj FamousMj
05/07/2017 11:11 AM
The Lich Yard
spector knight is a cheater
0 0
Mj FamousMj
05/07/2017 10:58 AM
Pridemoor Keep
0 0
josh superjosher11
05/07/2017 10:49 AM
Plains (Specter)
starting new game+
0 0
danny websymphony
05/07/2017 10:44 AM
Armor Outpost
1 0
josh superjosher11
05/07/2017 10:44 AM
Tower of Fate (Specter)
this is an amazing game. The story is beautiful (along with the graphics), and the gameplay is great
4 0
JfWood catocat9001
05/07/2017 10:29 AM
Plains
i have a hell of a code it's tvsvueio
2 0
Buzz CheeseMo3rd
05/07/2017 10:18 AM
Tower of Fate: Entrance (Specter)
This stage is the absolute WORST on New Game+. Only 2 checkpoints for a difficult and long level.
6 0
Hayden dirtohana
05/07/2017 9:55 AM
Plains (Specter)
0 0
dude rosenbhh
05/07/2017 8:24 AM
The Lich Yard
Am I the only one who thinks Body Swap Shield Knight looks very similar to the original?
2 0
Noah Smashking1210
05/07/2017 7:55 AM
Clockwork Tower
yeah clock tower boss is the best
0 0
Blu BluTallulah
05/07/2017 7:15 AM
Armor Outpost
4 0
Jonas Skyrobert24
05/07/2017 7:04 AM
Plains (Specter)
I love this update specter knight is the best!
1 0
James Jamesmip
05/07/2017 5:49 AM
The Lich Yard
2 0
Roger rogerf1025
05/06/2017 11:00 PM
Tower of Fate (Specter)
breaking the lamp above the knight guy will make him red
1 0
Roger rogerf1025
05/06/2017 10:55 PM
Tower of Fate (Specter)
what if the skulls you give red where the skulls of his race.
0 0
Gameknight DOOM456
05/06/2017 9:46 PM
Clockwork Tower
i love specter of torment
2 0
Roger rogerf1025
05/06/2017 9:29 PM
The Lich Yard (Specter)
i wonder if someone hides there bedroom here
0 0
Nicky nicholasjones_02
05/06/2017 7:34 PM
Plains
how do you get to other side jump on bubble but pops
1 0
Nicky nicholasjones_02
05/06/2017 7:33 PM
Plains
0 0
X LordX19
05/06/2017 6:52 PM
Pridemoor Keep (Specter)
King Knight fell in the hole with me. (it literally happened!)
2 0
Mj FamousMj
05/06/2017 6:30 PM
Explodatorium (Plague)
Hulk + Wolverine = this.
1 0
Mj FamousMj
05/06/2017 6:17 PM
Clockwork Tower
Tinker bot 2000
2 0
julio link7700
05/06/2017 5:44 PM
Torre del Hado (Specter)
yolo ya me pasate el guego gg
5 0
james lilyoshidude
05/06/2017 5:18 PM
Lost City (Specter)
this game is awesome
2 0
Márquez Ernst_Marq
05/06/2017 4:12 PM
Tower of Fate (Specter)
third time...
1 0
human luckyzeebeez2
05/06/2017 3:44 PM
Plains (Specter)
1 0
FDSM RidleyRulez
05/06/2017 3:38 PM
Tower of Fate (Specter)
What the heck was up with that scene with Gall??
2 0
Ady adylpika
05/06/2017 3:37 PM
Explodatorium
1 0
Sope sci24680
05/06/2017 2:55 PM
Clockwork Tower
...and the second phase wasn't half as bad by the looks of it
0 0
Sergio sergio_is_rad
05/06/2017 2:04 PM
Troupple Pond
Hail the Troupple King!
2 0
Cara Cara1021
05/06/2017 1:57 PM
Plains (Plague)
0 0
Pαη¢hθ ExelsioR_97
05/06/2017 1:11 PM
Finca de Liches (Specter)
1 0
JfWood catocat9001
05/06/2017 12:49 PM
Plains
mmmmm tatortots *cling* AHHHHHHH
2 0
JfWood catocat9001
05/06/2017 12:21 PM
Lost City (Specter)
imjjikhjgjlgu
1 0
ςρσσργ~♪ Jorden02
05/06/2017 11:36 AM
Plains
I missed this game.
5 0
Sammy Sambo-Kane
05/06/2017 11:29 AM
Plains (Specter)
soooo hard
1 0
JfWood catocat9001
05/06/2017 11:21 AM
Explodatorium (Specter)
WHY DOES THE FLAME FOLLOW THE WATER?!?!?
4 0
JfWood catocat9001
05/06/2017 11:18 AM
Explodatorium (Specter)
i was busy reading a post and a skeleton knocked me in a hole!!
4 0
JfWood catocat9001
05/06/2017 10:56 AM
Pridemoor Keep (Specter)
fall in a hole when you defeated him it looks dramatic!
1 0
JfWood catocat9001
05/06/2017 10:52 AM
Pridemoor Keep (Specter)
3 0
JfWood catocat9001
05/06/2017 10:48 AM
Pridemoor Keep (Specter)
2 0
JfWood catocat9001
05/06/2017 10:46 AM
Pridemoor Keep (Specter)
GO BOOMERANG SYETH GO!!
2 0
JfWood catocat9001
05/06/2017 10:01 AM
The Lich Yard (Specter)
I LOVE THIS MUSIC
0 0
JfWood catocat9001
05/06/2017 9:39 AM
Tower of Fate (Specter)
THE DOG IS VOMITING GOLD!!!!
2 0
Gavitron Gavatron987
05/06/2017 9:09 AM
Tower of Fate: Entrance (Plague)
0 0
x-crow cadenmonsterpie
05/06/2017 8:56 AM
Plains (Specter)
i beat the furst boss yeah
1 0
danny websymphony
05/06/2017 8:51 AM
Bottomless Quarry (Plague)
who will play the stages that need items
1 0
champ cohen0726
05/06/2017 8:21 AM
Tower of Fate (Specter)
I want the kiss of death? i do have i---ahhhhhhhhhhhhhhhh
4 0
JfWood catocat9001
05/06/2017 7:47 AM
Plains (Plague)
your blown up bk
0 0
dude rosenbhh
05/06/2017 7:43 AM
Pridemoor Keep
There's a secret in this level. It's like the "HAL" rooms in Kirby games.
2 0
JfWood catocat9001
05/06/2017 7:43 AM
Plains (Plague)
OH YES YES YES THIS PART TOOK SO LONG YES F YEAH YES YES YEEEEES!!!!
0 0
JfWood catocat9001
05/06/2017 7:41 AM
Plains (Plague)
you can't stop my crouching tiger kung-fu skills
0 0
Devon Metallix1135
05/06/2017 7:33 AM
Flying Machine (Specter)
Come to think of it, Every Knight stage sounds like a Mega Man stage.
1 1
Devon Metallix1135
05/06/2017 7:24 AM
Explodatorium (Specter)
Is it me ore does plauge knight's stage sound like a Mega Man stage?
1 0
Blu BluTallulah
05/06/2017 7:13 AM
Explodatorium
5 0
Fudgeman32 fudgeman32
05/06/2017 7:12 AM
Tower of Fate (Specter)
The grinding cloak can also help. Be warned. It takes time to get used to it.
3 0
Devon Metallix1135
05/06/2017 7:03 AM
Tower of Fate (Specter)
Still waitin for King Knight's dlc. Also, I FOUND ALL THE RED SKULLS!!!!
9 0
Austin taylorfox123
05/06/2017 6:58 AM
The Lich Yard (Specter)
Hate black outs , but i shall go on
0 0
Blu BluTallulah
05/06/2017 6:34 AM
Explodatorium
0 0
Fnaf gaurd avidreader1085
05/06/2017 6:26 AM
Tower of Fate (Specter)
bra what just happened (got kissed by gay boy)
4 0
Matthew Bradyface999
05/06/2017 6:14 AM
Plains
yeah beat the boss!
1 0
noa Datzuga
05/05/2017 11:22 PM
Campiña (Specter)
wow!!!
0 0
Dekgear juanpablo94
05/05/2017 10:33 PM
Pridemoor Keep (Specter)
esta calavera casi se me escapa!!
0 0
Jack exitinyourhead
05/05/2017 9:37 PM
Clockwork Tower (Specter)
this boss is getting nerve my ons
1 0
Jack exitinyourhead
05/05/2017 8:59 PM
Tower of Fate (Specter)
the enchantress has the cutest laugh
3 0
Jack exitinyourhead
05/05/2017 8:56 PM
Flying Machine (Specter)
hardest boss so far. not saying much but still.
0 0
Blu BluTallulah
05/05/2017 7:42 PM
The Lich Yard
1 0
danny websymphony
05/05/2017 7:33 PM
Explodatorium (Plague)
why are this coin in a relay hard spot
1 0
Blu BluTallulah
05/05/2017 7:29 PM
The Lich Yard
2 0
Butt Retoru
05/05/2017 7:25 PM
Explodatorium (Specter)
This prequal is awesome i recomed this too people that don't own a wii u
0 0
Blu BluTallulah
05/05/2017 7:09 PM
Pridemoor Keep
0 0
julio link7700
05/05/2017 7:00 PM
Campiña (Specter)
eee soy fabtasna
0 1
Spence spencerhi
05/05/2017 6:23 PM
Flying Machine (Specter)
We aren't flying! We're falling, with style!
7 0
Cooper S Willythewaffle
05/05/2017 6:20 PM
The Lich Yard (Plague)
FINALLY!!!
0 0
JfWood catocat9001
05/05/2017 6:14 PM
The Lich Yard
fgcffbnbb
0 0
FDSM RidleyRulez
05/05/2017 5:58 PM
Tower of Fate (Specter)
Red's a neat character. :D
0 0
Alex Allav866
05/05/2017 4:28 PM
The Lich Yard
I got bad RNG and spawned 3 more ghosts from hitting the graves. No, get away from me!!
0 0
GamerDoge tdk91106
05/05/2017 4:19 PM
Clockwork Tower
so mechanical
0 0
Alex Allav866
05/05/2017 3:40 PM
Plains
Testing out my NES Mini's control pad with this game! It feels nice to have 33 games to use it with!
3 0
JJ JJ0865
05/05/2017 3:01 PM
Tower of Fate: Entrance
0 0
Cooper S Willythewaffle
05/05/2017 2:58 PM
Stranded Ship
Get dunked on polar knight!
2 0
Cooper S Willythewaffle
05/05/2017 2:50 PM
Stranded Ship
Who is your favorite knight?
0 0
Colemine link2004island
05/05/2017 2:18 PM
Stranded Ship
Do NOT use the mail of momentum on this level. It only makes the ice more slippery.
0 0
Daerey daerey
05/05/2017 1:16 PM
Pridemoor Keep (Specter)
Don't you just love it when you're stuck on one part?
0 0
EthanL. thekenlong
05/05/2017 12:50 PM
Stranded Ship (Specter)
end me lol
0 0
.......... jayvian06
05/05/2017 12:45 PM
Plains
i beat black knite!!
1 0
Chris Fanloser
05/05/2017 12:01 PM
Pridemoor Keep
How do I do this jump?
0 1
Nick Corbenator28
05/05/2017 10:20 AM
Tower of Fate (Specter)
bonding soul is awsome
1 0
Myles MylesPatrick
05/05/2017 5:07 AM
Pridemoor Keep
Aewsome!
2 0
alexander gamezonerepair
05/05/2017 4:24 AM
Villa
/e dance
0 0
alexander gamezonerepair
05/05/2017 4:23 AM
Villa
alguien me esta montando
0 0
alexander gamezonerepair
05/05/2017 4:20 AM
Villa
use un modo gigante y es mas facil matar a los bosess
1 1
GameBroy GameBroy-Color
05/05/2017 2:07 AM
The Lich Yard
butts
3 0
Rivet Gear DragonLord4444
05/04/2017 8:08 PM
Encounter - Phantom Striker
We meet again...my electrical cohort
2 0
Rivet Gear DragonLord4444
05/04/2017 7:49 PM
Hall of Champions
I pay 5000 gold to get in, save this place for ghosts, and all i get is 50$? .............. worth it
5 0
Sarons grodoman
05/04/2017 7:30 PM
Tower of Fate (Specter)
CUUURSE YOOOU HORAAAAACE!
4 0
Sihy Sihyda
05/04/2017 7:25 PM
Tower of Fate: Entrance (Specter)
I wonder why is a platform there in the second book
2 0
Kykai3212™ kykai3212
05/04/2017 7:14 PM
Plains (Specter)
may the 4th be with you!
3 0
Jack exitinyourhead
05/04/2017 6:09 PM
Memory of Adventure (Specter)
holy shot this game only gets better
0 0
Jacob jacobLarson0915
05/04/2017 5:58 PM
Iron Whale
ooh its blue chester must be in there... oh god nintendo...why...why!
0 0
Jack exitinyourhead
05/04/2017 5:56 PM
Pridemoor Keep (Specter)
can i just kill king knight already
0 0
Four eyes Blastbox22
05/04/2017 5:47 PM
The Lich Yard (Specter)
They say Specter Knight hides a lair here...
0 0
Uncle Tony Bloatedtoad
05/04/2017 5:35 PM
Tower of Fate (Specter)
11 0
Jonas birdbird1515
05/04/2017 5:18 PM
Forest of Fishing (Plague)
so fun
2 0
Jack exitinyourhead
05/04/2017 5:11 PM
Plains (Specter)
sha bamf
1 0
danny arkstone
05/04/2017 5:08 PM
Explodatorium (Specter)
so easy as specter knight
2 1
Gamemaster endermen4253
05/04/2017 5:08 PM
Plains
I'm bouncing on my brother infinitely
1 0
Sarons grodoman
05/04/2017 4:45 PM
Tower of Fate: Entrance (Specter)
So this is it...this was a short game.
1 0
Porter porter100
05/04/2017 4:33 PM
Pridemoor Keep
Because of me wasting my money. i have beaten king knight
3 0
martin nit-ram317
05/04/2017 4:29 PM
Plains (Specter)
0 0
shamwow cactus_family_41
05/04/2017 4:28 PM
Explodatorium (Specter)
I love this great remix music
7 0
shamwow cactus_family_41
05/04/2017 4:22 PM
Troupple Pond
I love the Trouple King's dance
1 0
shamwow cactus_family_41
05/04/2017 4:17 PM
Clockwork Tower
I like corn
0 0
Martin martinbrennan428
05/04/2017 2:26 PM
Stranded Ship
What do I do here? :(
0 0
chara preston0506
05/04/2017 2:16 PM
Encounter - Baz
this game is goooood!!!!!!!!!
4 0
.......... jayvian06
05/04/2017 12:46 PM
Plains (Plague)
0 0
DMIA MiaMacMac
05/04/2017 12:24 PM
Tower of Fate (Specter)
0 0
Sarons grodoman
05/04/2017 11:15 AM
Encounter - Baz
Poor Baz. At least he gets his happy ending in Plague Knight's story...Sort of.
0 0
Dillon goldendelta
05/04/2017 10:07 AM
Pridemoor Keep (Specter)
one of my fav songs in this game
5 0
liam liamvis
05/04/2017 8:30 AM
Tower of Fate (Specter)
2 1
Zach zach1293
05/03/2017 10:38 PM
Pridemoor Keep
I love this game so much that I bought it for both Wii U and 3DS lol.
3 0
DMIA MiaMacMac
05/03/2017 9:36 PM
Tower of Fate (Specter)
oh my god i love darkness ♥♡♥♡♥♡♥♡♥♡♥♡♥♡♥♡♥♡♥♡♥♡♥♡♥♡♥♡♥♡♥♡♥♡♥♡♥♡and i made everybody girls
2 0
Aidan aidan_doyle
05/03/2017 5:44 PM
Explodatorium (Specter)
Hm, why am I reminded of Super Mario Bros?
4 0
jasper momjabbar
05/03/2017 5:43 PM
Flying Machine
this game is to hard ]=(
1 0
jasper momjabbar
05/03/2017 5:33 PM
Flying Machine
0 0
Mr. SAF MichaelSAF
05/03/2017 4:47 PM
Tower of Fate (Specter)
Just beat the tower ooohhh my lord i am awesome
2 2
Dave Primetroidave
05/03/2017 4:43 PM
Plains (Specter)
dtjj
2 0
Four eyes Blastbox22
05/03/2017 4:25 PM
Tower of Fate: Entrance (Specter)
The Dread Talon can pierce this Boss Bass-wannabe's hide!
3 0
Four eyes Blastbox22
05/03/2017 4:03 PM
Tower of Fate: Entrance (Specter)
If you're not sure if a place is safe, check the blocks; crush-risky ones look a little different!
0 0
Jerry gerardo4455
05/03/2017 3:25 PM
Explodatorium
Hello shovel knight waddayadoing
0 0
logan loganmil
05/03/2017 2:44 PM
Tower of Fate (Specter)
How do i find the curio at the explodetoriom ( i dont know how to spell it ^^^ )
1 0
Melaghan Melaghan
05/03/2017 1:59 PM
Stranded Ship (Specter)
0 0
Rivet Gear DragonLord4444
05/03/2017 1:52 PM
Iron Whale (Specter)
I HATE THIS FISH!!!
7 1
Sarons grodoman
05/03/2017 1:52 PM
Plains
What, no posts? I'LL SHOW YOU!
2 0
Jacob rightbackatcha77
05/03/2017 1:30 PM
Iron Whale (Specter)
Well, this is bad.
2 0
Phoenix stevie3947
05/03/2017 1:05 PM
Tower of Fate (Specter)
AM I THE ONLY ONE THAT THINKS THIS SHOULD GET A 10/ 10
8 0
Phoenix stevie3947
05/03/2017 1:03 PM
Tower of Fate (Specter)
RED 'S STORY IS SO CUTE!
2 0
link zakalope
05/03/2017 1:02 PM
Tower of Fate (Specter)
funnnnn
1 0
Phoenix stevie3947
05/03/2017 1:01 PM
Tower of Fate (Specter)
THIS GAME IS SOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO GOOD
3 0
Sentinel Sentineluno2001
05/03/2017 12:41 PM
Nave Varada (Specter)
Ye \ :v /
2 0
Audrey Sessapee
05/03/2017 5:08 AM
The Lich Yard
mmmmmmmhhhhhhhhhhhhh!!!!!!!!!
1 0
Audrey Sessapee
05/03/2017 5:05 AM
The Lich Yard
skeleton get stuck?
1 0
Bob leatherwood456
05/03/2017 2:11 AM
Tower of Fate (Specter)
DUCK YEAH
0 0
******* boiusuck
05/02/2017 8:30 PM
Plains (Specter)
i like ded
5 0
Ganon360 Mr.ganon360
05/02/2017 8:03 PM
Tower of Fate (Specter)
give the cat a bauble win a prize
0 0
Ganon360 Mr.ganon360
05/02/2017 7:54 PM
Plains (Specter)
if i didn't try for that red skull i wouldn't have died XS
3 0
OPvP★Dam3n UnspeakableLuck
05/02/2017 7:54 PM
Iron Whale
its him
1 0
Ganon360 Mr.ganon360
05/02/2017 7:42 PM
Plains (Specter)
getting the slash angle right takes work but haven't gotten hit yet XD
1 0
OPvP★Dam3n UnspeakableLuck
05/02/2017 7:25 PM
The Lich Yard
specter knight
0 0
OPvP★Dam3n UnspeakableLuck
05/02/2017 6:37 PM
Pridemoor Keep
for shovels
6 0
link linksmith
05/02/2017 5:55 PM
Troupple Pond (Plague)
i like king knight
0 0
Axel D Great_AXL0_0
05/02/2017 4:55 PM
Bosque en Fase
2 0
Axel D Great_AXL0_0
05/02/2017 4:44 PM
Finca de Liches
1 0
Sarons grodoman
05/02/2017 4:42 PM
Tower of Fate (Specter)
Man this game is awesome.
12 0
Four eyes Blastbox22
05/02/2017 4:22 PM
The Lich Yard (Specter)
Try using the Bounding Soul to suss out those ghostly walls!
1 0
Dem. Salchipappa
05/02/2017 4:18 PM
Lost City (Specter)
0 0
Asriel eonkohr9
05/02/2017 3:27 PM
Lost City (Specter)
almost completed this boi!
0 0
will dumbdonkey
05/02/2017 3:14 PM
The Lich Yard (Specter)
i died àlot
3 0
Four eyes Blastbox22
05/02/2017 3:06 PM
Flying Machine (Specter)
Have trouble getting below fans? Try clinging to a wall and immediately falling by pressing down!
4 1
Drew Eviscerate
05/02/2017 2:10 PM
Plains
5 0
Jonathan shanoa123
05/02/2017 12:51 PM
Campiña (Specter)
Specter Knight is awesome!
1 0
. Left4Wafflez
05/02/2017 11:47 AM
Pridemoor Keep (Specter)
King knight,but with FALLING!
0 0
Russel sonicrus25
05/02/2017 10:59 AM
The Lich Yard (Plague)
hoi
1 0
champ cohen0726
05/02/2017 10:48 AM
Iron Whale (Specter)
ko
1 0
Steven blakshema
05/02/2017 9:29 AM
Tower of Fate (Specter)
That mirror... Sure looks like something fills that marble sized hole...
0 0
Mike MikeD105
05/02/2017 6:20 AM
Village
10 0
Wolfen Wolfy0000
05/01/2017 10:45 PM
Torre del Hado (Specter)
alguien sabe sobre el cuarto personaje?
2 0
Wolfen Wolfy0000
05/01/2017 10:33 PM
Campiña (Specter)
iniciando specter knight genial!
2 0
James JJ_Da_B
05/01/2017 9:24 PM
Tower of Fate (Specter)
Haha love the new shops
6 0
pickle dibbydopickle
05/01/2017 9:06 PM
Village
why are you reading this? go back to playing the game.
11 0
Devon Metallix1135
05/01/2017 7:58 PM
Hall of Champions
I just found out that u can fight Kratos in the game, but the secret doesn't work yet.
2 1
shamwow cactus_family_41
05/01/2017 5:20 PM
Encounter - Reize
Reize please no
0 0
shamwow cactus_family_41
05/01/2017 5:18 PM
Explodatorium
yesss, beat Plauge Knight on my first try
0 0
shamwow cactus_family_41
05/01/2017 5:06 PM
Explodatorium
SO MANY RATS!
3 0
Isaac Labrynian_Rebel
05/01/2017 4:37 PM
Lost City (Specter)
I'm doomed
1 0
tabz smilypop
05/01/2017 4:23 PM
Flying Machine
I have not raged about a level in a long time but this one took the cake
3 0
Olomosholo Olomosholo
05/01/2017 4:05 PM
Tower of Fate (Specter)
The final level is so hard
0 0
shamwow cactus_family_41
05/01/2017 3:53 PM
Pridemoor Keep (Specter)
I think i'd be cool if king knight was a prince since this is in the past
5 0
Devon Metallix1135
05/01/2017 3:16 PM
Lost City (Specter)
Well this will be a bother.
0 1
Robert pizzza4ever
05/01/2017 2:33 PM
Flying Machine (Specter)
douche ahead
0 0
Goat jamswiiu
05/01/2017 2:22 PM
The Lich Yard (Specter)
so hard lol easy
0 0
Mitch E B mitchb02
05/01/2017 2:21 PM
Troupple Pond
1 0
cam hot_gummy_bear
05/01/2017 2:06 PM
Pridemoor Keep (Plague)
poooooooooooop
3 0
Rowan Rowan01
05/01/2017 12:59 PM
The Lich Yard (Specter)
get over with it phantom stricker (non stop lighting at phase 2
2 0
Rowan Rowan01
05/01/2017 12:56 PM
The Lich Yard (Specter)
hit fantom stricker after the 2 separate waves to cancle wave wall
1 0
Adam HouseLahnum
05/01/2017 12:36 PM
Tower of Fate: Entrance
hee hee
1 0
Dyz89 Dyz-89
05/01/2017 2:26 AM
Tower of Fate (Specter)
Really loving this game, i keep forgetting to go to sleep early!
1 0
Ricardox RicardoSaenz
04/30/2017 10:16 PM
Campiña
Charly's playing
1 0
Mike grumpyferaligatr
04/30/2017 9:40 PM
Explodatorium (Specter)
0 0
Mike grumpyferaligatr
04/30/2017 9:38 PM
Explodatorium (Specter)
...good one, Plague.
0 0
toon'star lilmonsto
04/30/2017 8:37 PM
Stranded Ship (Specter)
2 0
shamwow cactus_family_41
04/30/2017 7:31 PM
Tower of Fate: Entrance (Specter)
THIS MUSIC.. IS AMAZING!
7 0
shamwow cactus_family_41
04/30/2017 7:26 PM
Iron Whale (Specter)
YEAH just destroyed treasure knight super easily
2 0
cheche*_* thetotorobaby
04/30/2017 7:00 PM
Tower of Fate: Entrance
infinadagger:]
1 0
shamwow cactus_family_41
04/30/2017 6:54 PM
Clockwork Tower (Specter)
This level is so hard, but for some reason it's still fun
1 0
Evono pikalink16
04/30/2017 6:47 PM
Tower of Fate (Specter)
Use the judgement rush it really helps and if you use the coin the death floor slows down too
4 0
AdriotSoul luigi767
04/30/2017 6:38 PM
Tower of Fate: ????
lookmi
1 0
Evono pikalink16
04/30/2017 6:00 PM
Tower of Fate (Specter)
Just beat the challenge 10th try! woo! neveragain....
1 0
Jecht Heros_Shade182
04/30/2017 5:51 PM
Tower of Fate (Specter)
I DID IT WOOHOO
0 0
Cooper KupaCooper
04/30/2017 5:24 PM
Village
HUB AREAS! AWSOME
6 0
Marq young-peezy
04/30/2017 5:15 PM
Pridemoor Keep (Plague)
Taste my bombs.
1 0
Cooper KupaCooper
04/30/2017 5:11 PM
Plains
Soundtrack included!
0 0
Cooper KupaCooper
04/30/2017 5:05 PM
Plains
Stuck on level one
3 0
sparky WVCaillou
04/30/2017 4:35 PM
Village (Plague)
my upgrades won't work
3 0
Russel sonicrus25
04/30/2017 2:20 PM
Tower of Fate: Entrance (Specter)
halp
2 0
colin awesomepokmon
04/30/2017 1:58 PM
Clockwork Tower (Specter)
love this update!!!
2 0
Lj lucorian
04/30/2017 1:44 PM
Tower of Fate: Entrance
1 0
Soysal5000 SirSalahad
04/30/2017 1:35 PM
Pridemoor Keep (Specter)
DUMB LAVA POTS
1 0
nerd SuperThwomp
04/30/2017 1:29 PM
Stranded Ship (Specter)
okthx
1 0
shamwow cactus_family_41
04/30/2017 1:18 PM
Explodatorium (Specter)
Wow plauge knight is so easy
2 0
Soysal5000 SirSalahad
04/30/2017 1:15 PM
Tower of Fate (Specter)
3 0
shamwow cactus_family_41
04/30/2017 12:55 PM
Stranded Ship (Specter)
FINALLY I BEAT POLAR NIGHT!
1 0
Russel sonicrus25
04/30/2017 12:55 PM
Clockwork Tower (Specter)
hoi
1 0
shamwow cactus_family_41
04/30/2017 12:52 PM
Stranded Ship (Specter)
Polar knight just killed me and when I died he taunted me ._.
0 0
joey chiefcool9
04/30/2017 12:49 PM
The Lich Yard (Plague)
the boss fight is too hard!!!
1 0
Austin taylorfox123
04/30/2017 12:24 PM
Plains (Specter)
2 0
Nick nick9255
04/30/2017 12:18 PM
The Lich Yard (Specter)
I got this game
1 0
Rocket Warghet
04/30/2017 12:14 PM
Villa
no puedes pasar porque llevas un arma espera es una pala puedes pasar xD
4 0
Audrey Sessapee
04/30/2017 12:13 PM
Village
ez bos fites
1 0
Aidan aidan_doyle
04/30/2017 12:11 PM
Tower of Fate (Specter)
I a m n o t a m i r r o r
4 0
Aidan aidan_doyle
04/30/2017 11:54 AM
Plains (Specter)
Aw, he's got a pet war piggy.
3 0
joey chiefcool9
04/30/2017 11:46 AM
The Lich Yard (Specter)
how do I beat phantom striker?
1 0
Burner BMTrick
04/30/2017 11:32 AM
Tower of Fate: Ascent
The rest of the level could be AWSOME, but I WOULD STILL HATE IT CUZ OF THIF FRICKIN PART!!!!!!
2 0
Audrey Sessapee
04/30/2017 11:30 AM
The Lich Yard
get ready shovelers
1 0
€¶£$‡√★º§¿ EliteAleek237
04/30/2017 10:34 AM
The Lich Yard (Specter)
Nya ha ha
1 0
KFC CEO PixeldMan
04/30/2017 10:32 AM
Iron Whale
ohhhh boy
1 0
aizakku pianoorgan
04/30/2017 10:21 AM
Tower of Fate (Specter)
spectre knight has some of the best gameplay i've ever seen!
8 0
KFC CEO PixeldMan
04/30/2017 10:16 AM
Iron Whale
I have died
0 0
Kat Br0nyDash
04/30/2017 10:16 AM
Tower of Fate: Entrance (Specter)
I hate this game!
2 0
Andrew AndyBeck
04/30/2017 9:44 AM
Plains (Specter)
aliky
3 0
Matthew Mecha-KnightXt
04/30/2017 9:39 AM
Rematch: Plague Knight
As if one wasn't bad enough.
1 0
Kat Br0nyDash
04/30/2017 9:04 AM
Tower of Fate (Specter)
I love this game more than I love having good grades!
2 0
Dekgear juanpablo94
04/30/2017 9:03 AM
Explodatorium (Plague)
el mejor jefe!!
0 0
Connie schmiggins
04/30/2017 9:01 AM
Explodatorium
i beat plague knight !!!
1 0
Connie schmiggins
04/30/2017 8:54 AM
Explodatorium
0 0
Connie schmiggins
04/30/2017 8:50 AM
Explodatorium
plague knight is so haard to beat!!!
2 0
K Forte lightning_kf116
04/30/2017 8:10 AM
Stranded Ship (Specter)
This guy gave me a run for my money as Shovel Knight. He's SUPER EASY as Specter Knight.
3 0
Connie schmiggins
04/30/2017 8:05 AM
Village
2 0
danny arkstone
04/30/2017 7:50 AM
Plains (Specter)
yyeah boooi
1 0
K Forte lightning_kf116
04/30/2017 7:50 AM
Clockwork Tower (Specter)
Wow. What a boss fight. Tinker Knight and Plague Knight were my favorites so far.
2 0
Max bra shanny26
04/30/2017 7:45 AM
The Lich Yard (Specter)
im specter knight in the lich yard!
0 0
Max bra shanny26
04/30/2017 7:30 AM
Plains (Specter)
i have a cheat code stqqtxvx.try it.
6 0
JfWood catocat9001
04/30/2017 7:26 AM
Tower of Fate (Specter)
ok i am a underling reize.
0 0
JfWood catocat9001
04/30/2017 7:25 AM
Tower of Fate (Specter)
I AM NOT A PUPPET RIEZE!!!
3 0
Russel sonicrus25
04/30/2017 7:21 AM
Tower of Fate: ????
halp
1 0
Fudgeman32 fudgeman32
04/30/2017 7:19 AM
Lost City (Specter)
Trap Ahead
1 0
Russel sonicrus25
04/30/2017 7:17 AM
Tower of Fate: ????
i died when she had three full circles
2 0
JfWood catocat9001
04/30/2017 7:14 AM
Tower of Fate (Specter)
GET THE HELLNOUT OF MY ROOM!!!
1 0
William mari02608
04/30/2017 6:44 AM
Village (Plague)
tip for beating specter knight as pleag knight; go to a corner and wait for him to come then bomb
3 0
Ohana KMDR25
04/30/2017 6:39 AM
Tower of Fate (Specter)
†o ♭e … ♭rea†hless
4 0
joey chiefcool9
04/30/2017 6:17 AM
The Lich Yard (Plague)
how do you beat specter knight??
0 0
Axel chaoscontrol567
04/30/2017 6:02 AM
Tower of Fate (Specter)
yay the dark acolyte is back!
3 1
Axel chaoscontrol567
04/30/2017 3:40 AM
Plains
for the profile name put stqqtxvx
0 0
lil'O9 jaxon813
04/29/2017 9:46 PM
Plains (Plague)
2 3
Four eyes Blastbox22
04/29/2017 9:27 PM
Lost City (Specter)
Careful here; kick off this wall and you'll be kicking yourself. Because you'll die. Get it?
1 0
JfWood catocat9001
04/29/2017 9:16 PM
Pridemoor Keep (Specter)
anyone like this new game mode?
5 0
Four eyes Blastbox22
04/29/2017 8:57 PM
Lost City (Specter)
So long as you're on even level, you can walk on 'em. But a jump will spell death!
4 0
Four eyes Blastbox22
04/29/2017 8:34 PM
Flying Machine (Specter)
Be bold! Yours is the scythe that will cleave the cannonballs!
4 0
Four eyes Blastbox22
04/29/2017 8:32 PM
Flying Machine (Specter)
If you happen to have it, the Spider Scythe Curio works wonders here!
2 0
wiiston wiiston
04/29/2017 8:32 PM
Tower of Fate: ????
haiiiiiii
2 0
jace jacesmommy07
04/29/2017 7:30 PM
Iron Whale (Plague)
what the fish
1 0
Francisco Francisco35
04/29/2017 5:52 PM
Plains (Specter)
Specter of torment is hard!!! i died about 10 times before the boss
2 0
Izerz05 Izerz05
04/29/2017 5:39 PM
Iron Whale (Specter)
Where is the iron whale?
3 0
BANANA gophergoggle
04/29/2017 5:35 PM
Armor Outpost
1 0
BANANA gophergoggle
04/29/2017 5:33 PM
Armor Outpost
1 0
willmer Forever102
04/29/2017 5:12 PM
The Lich Yard
ok
3 0
Cameron itisI0
04/29/2017 5:01 PM
The Lich Yard
specter knight is stinkin hard
6 0
Izerz05 Izerz05
04/29/2017 4:52 PM
Lost City (Specter)
Gg mole knight
0 0
MemePolice AKDProductoins45
04/29/2017 4:33 PM
Pridemoor Keep
so EASY
5 0
MemePolice AKDProductoins45
04/29/2017 4:29 PM
Pridemoor Keep
shovel bounce off the book
3 0
Robert taydeu
04/29/2017 4:27 PM
Explodatorium
4 1
MemePolice AKDProductoins45
04/29/2017 4:27 PM
Pridemoor Keep
another one
0 0
MKE.W3E pork818
04/29/2017 4:18 PM
Tower of Fate (Specter)
i feel bad for ignoring the dancer now
5 0
MemePolice AKDProductoins45
04/29/2017 4:15 PM
Pridemoor Keep
how do i move on?
0 0
MemePolice AKDProductoins45
04/29/2017 4:07 PM
Pridemoor Keep
just found out you get a pink diamond by braking the save points
3 0
Conrad DoctorCon
04/29/2017 3:59 PM
Tower of Fate (Specter)
Just defeated Shield Knight! I like that she became a boss in Spectre of Torment!
5 0
Benny themaster_whizz
04/29/2017 3:50 PM
Pridemoor Keep
3 0
Skia Shadowd15
04/29/2017 3:50 PM
Plains
two shovel knight
1 0
Edison Edison_Tse
04/29/2017 3:31 PM
Explodatorium (Plague)
Goldarmors are too easy to beat wher you're plague knight!
0 0
MemePolice AKDProductoins45
04/29/2017 3:27 PM
Plains
i am the man, everybody knows my name
1 0
Edison Edison_Tse
04/29/2017 3:27 PM
Explodatorium (Plague)
What a rebel!
1 0
Edison Edison_Tse
04/29/2017 2:54 PM
The Lich Yard (Plague)
Goodbye Reaper!
1 0
Dani Oh_Boy_08
04/29/2017 2:33 PM
Flying Machine (Specter)
The Flying Machine's music is my 2nd favourite
3 1
Ronan SmashBro6409
04/29/2017 2:23 PM
Iron Whale (Specter)
Um...Wow...Ok...
4 0
Ronan SmashBro6409
04/29/2017 2:14 PM
Iron Whale (Specter)
Im getting Mega Man 2 Vibes...
5 0
Sophie TankGirlLives
04/29/2017 2:08 PM
Tower of Fate (Specter)
i will remember he is fat
3 0
Ronan SmashBro6409
04/29/2017 2:04 PM
Tower of Fate (Specter)
darn it the kiss of death worked XD
6 0
Mike Misko_Gigant
04/29/2017 2:03 PM
The Lich Yard (Specter)
how do i go up little bush with the wall thing
1 0
pito kroketah
04/29/2017 1:58 PM
Stranded Ship
this gam is super fun
0 0
stephen secret16648
04/29/2017 1:44 PM
Pridemoor Keep
i have done the whole game
0 0
Ronan SmashBro6409
04/29/2017 1:32 PM
Clockwork Tower (Specter)
Awesome Fight. nuff said
2 0
?! chknnugtsrawesom
04/29/2017 1:18 PM
Encounter - Baz
heugh
0 0
chris chriscool21
04/29/2017 1:00 PM
Flying Machine (Specter)
the rage is real!
3 0
Genis GenisT8SB
04/29/2017 12:18 PM
The Lich Yard (Specter)
I am missing only one red skull. I have no clue as to where it is in this stage.
4 0
Mittie Autocon21
04/29/2017 12:09 PM
Explodatorium
As fun as it is, I am not good at Shovel Knight at all :,D
0 0
★♀¤∞±←˙–•★ 1945CFam
04/29/2017 12:00 PM
Plains
Oh yeah getting my senses back! It feels so good!!!
2 0
ChainChomp snailjohnson
04/29/2017 11:46 AM
Frigid Flight
I BEAT THE ENHCANTTRESS
0 0
alan alanmajalca
04/29/2017 11:44 AM
Campiña (Specter)
gane
0 0
Josh Ex-Ninten_Fanboy
04/29/2017 11:38 AM
Stranded Ship
Try using the Chaos Sphere!
6 0
Luis CarlosMaccaroni
04/29/2017 11:37 AM
Ballena de Hierro
P*TO NIVEL LO ODIO >:V
0 0
Murphy Dusty_Hammer
04/29/2017 11:27 AM
Village
3 0
Benji falconpunch225
04/29/2017 11:09 AM
Clockwork Tower (Specter)
10/10 IGN
1 0
ChainChomp snailjohnson
04/29/2017 10:43 AM
Stranded Ship
to defeat polar knight use a phase locket for the spikes and flare wand for atact
2 0
Alex Alex719040
04/29/2017 10:20 AM
Flying Machine (Specter)
almost done
0 0
Colemine link2004island
04/29/2017 10:20 AM
Troupple Pond
All hail the Trouple king! May his stem grow long!
2 0
Blake blakechloe2008
04/29/2017 10:05 AM
Troupple Pond
3 0
lilpenguin LilPenguin2
04/29/2017 9:45 AM
Tower of Fate: ???? (Specter)
we hope you past this level
11 0
MKE.W3E pork818
04/29/2017 9:32 AM
Explodatorium (Specter)
this isn't the exploditorium i knew and loved ;-;
2 0
Devon Metallix1135
04/29/2017 9:22 AM
Tower of Fate (Specter)
Ok do i have to use only curios for the bosses to recruit them for spectre knight? HELP!
4 0
Plague <:= vitri0l
04/29/2017 9:21 AM
Tower of Fate (Specter)
THE KISS OF DEATH
2 0
lmjackin u imjackin_u_725
04/29/2017 9:18 AM
Pridemoor Keep (Plague)
use lob casing when fighting the gryphons
3 0
Dani Oh_Boy_08
04/29/2017 9:06 AM
The Lich Yard (Specter)
The Lich Yard has the best music
1 0
Plague <:= vitri0l
04/29/2017 9:05 AM
Iron Whale (Specter)
specter music is amazing!
3 0
Conrad DoctorCon
04/29/2017 9:01 AM
Tower of Fate (Specter)
Just coompleted Horace's challenge on like my 50th try!
8 0
Daddy Simmons.family22
04/29/2017 8:55 AM
Troupple Pond
2 0
uuuggghhh travics
04/29/2017 8:47 AM
Explodatorium
ichor is for lads who suck on watermelon flavored lollipops
5 0
jr Gazer76
04/29/2017 8:43 AM
Pridemoor Keep (Plague)
0 0
atlas gusphilip
04/29/2017 8:41 AM
The Lich Yard (Plague)
rest in peperionis reaper
0 0
:D jjmix101
04/29/2017 8:39 AM
Village
yeet
3 0
Beat xFrostedDonutx
04/29/2017 8:34 AM
Tower of Fate (Specter)
10/10 Everythingmakes sense now
4 0
Sans xX_noobslayr_Xx
04/29/2017 8:23 AM
Plains (Specter)
Does Black Knight count for the No-Hit achievement?
1 0
atlas gusphilip
04/29/2017 8:18 AM
The Lich Yard (Plague)
stupid skeleton in dark place
1 0
Plague <:= vitri0l
04/29/2017 8:18 AM
The Lich Yard (Specter)
I remember when i sold the phase locket
2 0
Plague <:= vitri0l
04/29/2017 8:15 AM
The Lich Yard (Specter)
this music is just...
0 0
Ryan zygardecrunchypb
04/29/2017 7:53 AM
Iron Whale (Specter)
Dread Talon can kill these iron snails
3 0
Dj BaptisteWU
04/29/2017 7:53 AM
Tower of Fate: ???? (Specter)
IT'S. THE. REMATCH.
3 0
Dekgear juanpablo94
04/29/2017 7:17 AM
Flying Machine (Specter)
Bastante facil el boss comparado con el nivel, aunque de todas formas fue genial !
1 0
Dekgear juanpablo94
04/29/2017 7:15 AM
Flying Machine (Specter)
de los niveles mas dificiles,y eso que tengo casi todos los curios! veamos que tal el boss...
0 0
andrewgame abcde9876
04/29/2017 7:07 AM
Armor Outpost
When did this all happen!
1 0
Axel chaoscontrol567
04/29/2017 6:58 AM
Tower of Fate (Specter)
why get rid of the dark acolyte
4 0
Culen MCtallica
04/29/2017 6:56 AM
Plains (Specter)
Dang near perfect game...
4 0
Ryan PeppySezZx2
04/29/2017 6:21 AM
Lost City
rip lol
4 0
Robert taydeu
04/29/2017 5:59 AM
Iron Whale (Specter)
Shoove knit:spookter is torn
1 0
joey chiefcool9
04/29/2017 4:56 AM
Plains
How do you beat dark knight (shovel of hope)
0 0
Jackal yoyopiraka
04/29/2017 4:47 AM
Tower of Fate (Specter)
dgyfgh
0 0
patience rbelivo
04/29/2017 4:10 AM
Lost City
lolololololololol mole knight i guess you let your fat get the best of you
1 0
Jake SuperGamerJohn
04/29/2017 2:05 AM
Plains
How Do I do multiplayer?
5 2
alexander gamezonerepair
04/29/2017 1:43 AM
Máquina Voladora (Specter)
ya gane el modo specter
1 0
Zach QuantumKraken
04/28/2017 9:17 PM
Pridemoor Keep
Beat King Knight! Maybe I can finally leave this Tavern...
1 0
ŔÝÁÑ maddog2005
04/28/2017 8:48 PM
Plains (Plague)
lol plague knight so easy
2 0
kyuu KentonKyuubi9Fox
04/28/2017 8:33 PM
The Lich Yard
3 0
dr.elmo jakedadmom
04/28/2017 8:20 PM
Knuckler's Quarry
you can not dash through this dirt
0 0
R.I.P. MV Fuego10
04/28/2017 7:05 PM
Tower of Fate (Specter)
Oi'm the 'EDGE FARMER,Oi' am!You think yer edgy,do ya?Prove it in the comments,Ye will!
5 4
l,l...¡¡¡¡ cesar35547
04/28/2017 6:53 PM
Jardin des Liches
2 0
jayden.L minecraftkixx
04/28/2017 6:52 PM
Stranded Ship
just beat spectre of torment and am very disapointed in the end
5 0
3rdparty PUNPUNONODERA
04/28/2017 6:23 PM
Pridemoor Keep
everything about this game is good, waiting until hype died was a mistake
0 0
kronos mightyodin
04/28/2017 6:01 PM
Pridemoor Keep (Specter)
wow pretty cool campaign!!!!!
0 0
Ryan BS_Alliance
04/28/2017 5:48 PM
Tower of Fate (Specter)
im actually from alladin
0 0
Ryan BS_Alliance
04/28/2017 5:47 PM
Tower of Fate (Specter)
i like puns
2 0
Ryan BS_Alliance
04/28/2017 5:46 PM
Tower of Fate (Specter)
am i secretly link?!
1 0
Ryan BS_Alliance
04/28/2017 5:45 PM
Tower of Fate (Specter)
yay! lord of the rings!
1 0
Ryan BS_Alliance
04/28/2017 5:44 PM
Tower of Fate (Specter)
well im a samurai
2 0
Ryan BS_Alliance
04/28/2017 5:42 PM
Tower of Fate (Specter)
i live in heck
2 0
joe personal_pizza
04/28/2017 4:40 PM
Village
0 0
joe personal_pizza
04/28/2017 4:36 PM
Village
1 0
Logan aaronnguyen
04/28/2017 4:22 PM
Plains
how do you dig
0 0
Duke Duke0108
04/28/2017 4:17 PM
Plains (Plague)
3 0
William mari02608
04/28/2017 4:13 PM
Tower of Fate (Specter)
0 0
★☆Theif!☆★ joejoe4life
04/28/2017 3:56 PM
Tower of Fate (Specter)
So Happy "Specter Night" Finally came! (a while ago...)
2 0
KrlocoSabe KrlocoSapbeLeiva
04/28/2017 3:45 PM
Campiña (Specter)
xupapiiii
1 0
Hashbrowns luigirobot767
04/28/2017 3:44 PM
Pridemoor Keep
itz gud
0 0
patience rbelivo
04/28/2017 2:07 PM
Iron Whale
cool fight
0 0
Monkey LegoMonkeyKing
04/28/2017 1:11 PM
Explodatorium
yes almost there
1 0
Fnaf gaurd avidreader1085
04/28/2017 12:58 PM
Tower of Fate (Specter)
speckter rules bra
4 0
Four eyes Blastbox22
04/28/2017 12:56 PM
Clockwork Tower (Specter)
Striking the Wizzem's gears cause them to float in the air!
2 0
Colton MeckyT
04/28/2017 12:49 PM
Plains
edtystxhcpahpmkt'cfuhgyvbhghuhhhhhhh
5 0
Tyler JakMaster1
04/28/2017 12:39 PM
The Lich Yard (Specter)
I love this expansion!!!
1 1
Fabio budega1002
04/28/2017 11:06 AM
Planícies (Specter)
esso e maluca porque depois vai ganhando muinto dinheira que loco e seila oque vai acontese depois.
0 0
EmmanoelBR EmmanoelXD
04/28/2017 7:33 AM
Clockwork Tower (Specter)
Already my favorite stage from Specter of Torment
5 0
marvelouss marvelouss
04/27/2017 8:27 PM
Tower of Fate (Specter)
still easy
3 0
marvelouss marvelouss
04/27/2017 8:27 PM
Tower of Fate (Specter)
super easy from spectater knight
0 0
Nate meme7879
04/27/2017 7:44 PM
Tower of Fate (Specter)
I just finished spector of torment, and... uh... it's... it is deep.
3 0
Gerald B. Goldenbat33
04/27/2017 7:20 PM
Tower of Fate (Specter)
Even though i didnt get anything great for the minigame i loved the challenge. King knight be good!!
5 0
Gerald B. Goldenbat33
04/27/2017 7:13 PM
Tower of Fate (Specter)
It's lonely at the top of this tower... But at least I beat Horace's Tower. I love Shovel Knight!!!
3 0
Axel KissMineAxe
04/27/2017 5:55 PM
The Lich Yard (Specter)
I want a propeller knight update
2 0
Pablo Pablito12345
04/27/2017 5:47 PM
Explodatorium (Specter)
level 2: done
0 0
Jay Jaytr0n
04/27/2017 5:32 PM
The Lich Yard
Its so spoopy here
7 2
Guma445 41danf
04/27/2017 5:14 PM
Armor Outpost (Plague)
WHY IS A GUY THAT SELLS HATS SO HARD TO BEAT!!!!
0 0
jacob mcarthurland
04/27/2017 5:06 PM
Encounter - Phantom Striker
almost at the enchantress fortress
0 0
Logan Wii3Boyz
04/27/2017 4:58 PM
Plains
brother playing the first time he sucks
2 0
brant surfsi1
04/27/2017 4:44 PM
Pridemoor Keep
I HATE BOOKS I HATE FLYING RATS AND I HSTE FALLING TAR >:(
1 0
HAVOK HAVOK13
04/27/2017 4:31 PM
Lost City (Specter)
I am the best justin
2 0
Javi SwungWater740
04/27/2017 4:21 PM
Plains (Plague)
I love the new campaings in this game!
0 0
brant surfsi1
04/27/2017 4:11 PM
Plains
THE BUTTS ARE TAKING OVER AHHHHHHH!!!!!!(in the name selector make your name x&butt and enjoy :)
1 0
Draisien chronophobia42
04/27/2017 3:37 PM
Plains (Plague)
0 0
N-ergy noaisawsom123
04/27/2017 3:35 PM
Tower of Fate: Entrance (Specter)
I can only find 4 skulls out of five on this level. Someone help me find the last one!
3 1
atlas gusphilip
04/27/2017 3:33 PM
Plains (Plague)
0 0
Cooper KupaCooper
04/27/2017 3:15 PM
Plains
Why Me
1 0
Deadinside Fnaf2mirianet
04/27/2017 1:52 PM
Tower of Fate (Specter)
How do I put this but this game is always entertaining
2 0
notmatt notmatt
04/27/2017 12:18 PM
Tower of Fate (Specter)
gettin suuuuc
3 0
Rivet Gear DragonLord4444
04/27/2017 11:27 AM
Shivering Sprint (Plague)
if the grumps ever play plague of shadows, this level will make arin SCREAM WITH RAGE!!!
2 0
Rivet Gear DragonLord4444
04/27/2017 11:02 AM
Tower of Fate (Specter)
And we still haven't put those iron bars on the windows...
3 0
********** sotop27
04/27/2017 10:13 AM
Explotatorium (Specter)
costruye una armadura por favor tengo 5000$ monedas
4 0
********** sotop27
04/27/2017 10:11 AM
Explotatorium (Specter)
es una bruja
0 0
Dj BaptisteWU
04/27/2017 6:06 AM
Clockwork Tower (Specter)
Welcome to Grand opening of Tinkertower climb. We hope you enjoy your trip!
5 0
Dj BaptisteWU
04/27/2017 5:48 AM
Stranded Ship (Specter)
Oh great, Return of DKC Tropical Freeze.
6 0
PepperGirl PepperGirl
04/27/2017 1:25 AM
Tower of Fate: Ascent
Gonna defeat the final boss in style by wearing my golden armor!
5 0
Nathan Ctenochaetus
04/27/2017 1:25 AM
Lost City (Specter)
behind you (no, really)
5 0
ant karkatvantas18
04/26/2017 10:43 PM
Tower of Fate (Specter)
the game+ mode for specter knight is very hard
1 0
Miguel Jr Warangel96
04/26/2017 10:02 PM
Stranded Ship (Specter)
He is just a cloud
4 0
lucas redfox1031
04/26/2017 9:51 PM
Village (Plague)
no! im not a bird im a plauge doctor!
6 0
Eddie UuDdLrBa1
04/26/2017 9:47 PM
The Lich Yard (Specter)
got the ghostly garb
1 0
Izerz05 Izerz05
04/26/2017 9:12 PM
Tower of Fate (Specter)
cringy dancing
1 0
Izerz05 Izerz05
04/26/2017 9:07 PM
The Lich Yard (Specter)
lol first try
0 0
Ryan Nintendista11
04/26/2017 8:27 PM
The Lich Yard
Let's get digging
1 0
Joni JohannaShoe
04/26/2017 8:16 PM
The Lich Yard
5 0
Sats theuniquesats
04/26/2017 8:06 PM
Fortaleza del Orgullo
así se vence!
1 0
Christian christian21706
04/26/2017 7:47 PM
Plains (Specter)
2 0
Luke Lukethe2th
04/26/2017 7:20 PM
Tower of Fate (Specter)
ALL SHALL FEAR PLAGUE KNIGHT!
3 0
Jacob thatoneguywho
04/26/2017 6:43 PM
Tower of Fate: Ascent
4 0
Roberto 142670
04/26/2017 5:55 PM
Torre del Hado (Specter)
De las mejores expansiones que eh jugado
3 0
rayman LilChamp06
04/26/2017 5:46 PM
Tower of Fate (Specter)
broccoli lady is back
5 0
Preston littlejohn81
04/26/2017 5:39 PM
Tower of Fate: ???? (Specter)
Skateboarding on a rail, toward a boss. So freaking awesome!!!
5 0
Meerkat Gackotko
04/26/2017 5:33 PM
The Lich Yard
3 0
StarLord spcmky
04/26/2017 5:18 PM
Pridemoor Keep (Specter)
Well Hidden Easter Egg, Don't You Think?
3 0
Manuel Manu-Ashes
04/26/2017 5:08 PM
Villa
alguien ya uso el cambio de cuerpo a sexo opuesto ? se ve divertido
2 0
William WillyD3
04/26/2017 5:05 PM
Tower of Fate (Specter)
rieze is hard to battle
1 0
Manuel Manu-Ashes
04/26/2017 5:04 PM
Fortaleza del Orgullo
usar el sexo opuesto es divertido
5 0
animetim keaton5703
04/26/2017 4:59 PM
Plains (Plague)
specter knight is easier
1 1
Four eyes Blastbox22
04/26/2017 4:29 PM
Plains (Specter)
Wait until you're below the bubble before tearing through it! You wouldn't want to dash into a pit!
0 0
Hamburger Renegatess
04/26/2017 3:54 PM
The Lich Yard
2 0
Grumpy_Man dedamandsizcool7
04/26/2017 3:53 PM
Plains (Specter)
why wont it let me jump up the ledge?!
9 1
Preston littlejohn81
04/26/2017 3:12 PM
Tower of Fate (Specter)
Only 1700 gold!? I wish Specter Knight can die again. :(
1 0
Scream Screamdead42
04/26/2017 3:08 PM
Campiña (Specter)
es bowser
0 0
Preston littlejohn81
04/26/2017 2:55 PM
Clockwork Tower (Specter)
looks like they gave him the moble gear.
1 0
Sniggles sniggles7
04/26/2017 2:34 PM
Peacetime Climb
you can't beat this
0 0
JOLLY JEFF Monsteratior
04/26/2017 1:32 PM
Tower of Fate (Specter)
I held down with Specter Knight's last costume while talking to the portal dude and he was dancing..
1 0
Cesar AnGorDeV
04/26/2017 1:07 PM
Finca de Liches
0 0
William WillyD3
04/26/2017 12:56 PM
Clockwork Tower (Specter)
awesome music!!!
7 0
William WillyD3
04/26/2017 12:53 PM
Tower of Fate (Specter)
is shield knight a boy or a girl?
0 1
Four eyes Blastbox22
04/26/2017 9:11 AM
Pitch'em and Switch'em
Inactive platforms leave dark outlines where they used to be! Use them to plan your jumps!
3 0
Julian Necromancer985
04/26/2017 8:48 AM
Flying Machine (Specter)
WOAH OK IM FALLING
2 0
Pogo Pogonator
04/26/2017 8:41 AM
Plains (Specter)
This is the most fun i've had with a pkatformer in a while!
3 0
Julian Necromancer985
04/26/2017 7:47 AM
Lost City (Specter)
uuh... mole city?
1 0
Akitowolf Akitowolf
04/25/2017 9:30 PM
Finca de Liches (Specter)
0 0
Julian Necromancer985
04/25/2017 8:29 PM
Iron Whale (Specter)
7 0
Mr.DaNkMeM theminigamer
04/25/2017 7:57 PM
Plains (Specter)
2 0
Julian Necromancer985
04/25/2017 7:55 PM
Tower of Fate (Specter)
2 0
Julian Necromancer985
04/25/2017 7:11 PM
Pridemoor Keep (Specter)
This song sounds ten times more happy! and this for specter knight?
8 0
Julian Necromancer985
04/25/2017 6:22 PM
Tower of Fate (Specter)
5 0
epiphyte epiphyte
04/25/2017 6:14 PM
Lost City (Specter)
going down as spector knight. Don't wait up.
1 0
landon softtacoking
04/25/2017 5:15 PM
Tower of Fate: Entrance (Specter)
FINALLY
3 0
landon softtacoking
04/25/2017 5:12 PM
Tower of Fate: Entrance (Specter)
i am supposed to be making money not losing it
2 0
Eddie UuDdLrBa1
04/25/2017 5:02 PM
Plains (Specter)
how do you get out of the wii u pad screen
4 1
Solarson Lucas32159
04/25/2017 4:33 PM
Tower of Fate (Specter)
I just defeated the final boss
3 0
AndO Quibbloboy
04/25/2017 4:23 PM
Plains (Specter)
Game is lit
2 1
Fandoms Fandoms_FitF
04/25/2017 4:01 PM
Tower of Fate (Specter)
my name jeff LOL XD 21!!!
0 0
Ty tyblkpey
04/25/2017 4:00 PM
Tower of Fate: Ascent
1 0
Rivet Gear DragonLord4444
04/25/2017 3:49 PM
Tower of Fate (Specter)
Just found out if u hold down in front of the memmec... well, do it and you'll find out for yourself
2 0
SwaySway Gamekid456
04/25/2017 3:36 PM
Tower of Fate (Specter)
Plauge Knight was actually pretty easy to kill
2 0
Johnny awesomeman6447
04/25/2017 3:25 PM
Clockwork Tower (Specter)
THIS LEVEL IS SO HARRRRRRRRRRRRRRRD
3 0
nathan2 KiwiBird39
04/25/2017 3:25 PM
Tower of Fate: Entrance (Specter)
it so HARD!!!!!!!!!!!!!!!!
5 0
Mjeku MjekuMati
04/25/2017 3:08 PM
Plains (Specter)
1 0
Liljosh Flamemaster2251
04/25/2017 2:32 PM
Flying Machine
1 0
Liljosh Flamemaster2251
04/25/2017 2:22 PM
Armor Outpost
1 0
Bonnie Kokefer
04/25/2017 1:25 PM
Ballena de Hierro (Specter)
lol
0 0
Wolfgang CadaverSandbag
04/25/2017 12:20 PM
Clockwork Tower (Specter)
The wait was worth it!!!!
2 0
NeoWay Neo_Way
04/25/2017 11:52 AM
Plains (Specter)
Black Knight is the new King Knight... his fight was a piece of cake despite the rhino.
2 0
StephenAlt StegoMcSaurus
04/25/2017 11:18 AM
Lost City (Specter)
This game rocks.
0 0
R.I.P. MV Fuego10
04/25/2017 11:10 AM
Tower of Fate (Specter)
dragon!
4 0
Jacob Fire4Life125
04/25/2017 10:40 AM
Tower of Fate (Specter)
Finally time to fight the final boss. reap on specter knight, and never quit.
1 0
Michael Mr.rubadub
04/25/2017 10:18 AM
Tower of Fate (Specter)
2 0
R.I.P. MV Fuego10
04/25/2017 10:08 AM
Tower of Fate (Specter)
when ye summons a skeleton and u has colded shoulder summon one use the cold shoulder then look abov
3 0
Zezinho Zezinhomii2
04/25/2017 7:48 AM
Máquina Voadora (Specter)
pereba!
0 0
Splatooner mvalviar
04/25/2017 1:49 AM
Tower of Fate (Specter)
hey guys tell me where are the skulls are (specter of torment)
4 0
Splatooner mvalviar
04/25/2017 1:11 AM
Tower of Fate (Specter)
Am I good at skateboards? or no?
7 0
Snowclaw SonicDoctor
04/25/2017 1:10 AM
Tower of Fate: ???? (Specter)
EZ
2 0
Splatooner mvalviar
04/25/2017 1:08 AM
Tower of Fate (Specter)
This Game Is So FREAKING AMAZING AND SUPER COOL!!!!!!!!!!!!!!!!!!!!!!!!! (Verily Please)
8 0
Norm NormtheStorm
04/25/2017 1:03 AM
Tower of Fate (Specter)
0 0
Kraken StarKraken
04/24/2017 10:20 PM
Pridemoor Keep (Specter)
starting this new story!!!
0 0
warren warrenebb
04/24/2017 7:53 PM
Tower of Fate (Specter)
10 0
Guma445 41danf
04/24/2017 7:19 PM
Explodatorium
the plaege boss is so stupidly hard
1 0
char giants69
04/24/2017 7:11 PM
Village
1 0
Guma445 41danf
04/24/2017 6:09 PM
Explodatorium
i have died so many times
0 0
Mustard krazytodd
04/24/2017 6:07 PM
Lost City (Specter)
MY BEETLE RETURNS TO SERVE THE SPECTER!!
1 0
Guma445 41danf
04/24/2017 6:06 PM
Explodatorium
i hate the pleage knight
0 0
Chris Neuro81
04/24/2017 6:02 PM
Plains
2 0
wiiston wiiston
04/24/2017 5:54 PM
Tower of Fate: ???? (Specter)
haiiiiii
2 0
Zack Zsendicott
04/24/2017 5:37 PM
Tower of Fate (Specter)
I made 5x as much gold just trying to get to the top.....
3 0
chase RobotChase4
04/24/2017 5:32 PM
Plains (Specter)
JHFHFGDGGVGDDHHFBFFDDCFddbbdbdmhrnfhuujcv
0 0
chase RobotChase4
04/24/2017 5:31 PM
Plains (Specter)
1 0
chase RobotChase4
04/24/2017 5:20 PM
Plains (Plague)
1 0
edward edward-kun64
04/24/2017 5:15 PM
Torre del Hado (Specter)
que divertido esta la aventura de specter knight es una pasada ;)
6 0
Ben HouserClan
04/24/2017 5:12 PM
Clockwork Tower (Specter)
Good thing I was wearing the green armor.
1 0
Jecht Heros_Shade182
04/24/2017 5:09 PM
Clockwork Tower (Specter)
this place sucks
3 0
Scraps ScrapLee
04/24/2017 4:03 PM
Clockwork Tower (Specter)
0 0
Ty tyblkpey
04/24/2017 3:50 PM
Tower of Fate: Entrance
I am kool. No! How I Die
1 0
me? sethio11
04/24/2017 3:39 PM
Tower of Fate (Specter)
trust me no matter how long it takes get the red skulls its worth it!
5 0
taylor taylorzzz
04/24/2017 3:39 PM
Explodatorium
im pretty good at this game
1 0
Bonnie Kokefer
04/24/2017 3:15 PM
La Ciudad Perdida (Specter)
que dificil
0 0
DanDLion DanDLionRO
04/24/2017 3:06 PM
Tower of Fate (Specter)
0 0
Will will110407
04/24/2017 2:57 PM
The Lich Yard (Plague)
Im having a great time with the new update
2 0
Noah NoahthepikachuX3
04/24/2017 2:17 PM
Tower of Fate (Specter)
i'm gonna hate new game plus soon
3 0
vincnt tohm52222
04/24/2017 2:13 PM
Plains
spector of torment is awsome
3 0
Brain Brainiac358
04/24/2017 2:12 PM
Pridemoor Keep (Specter)
it was different wheni wasshovel knight
1 0
Fyevava Fyevava
04/24/2017 1:09 PM
Plains (Plague)
xzdes?: >>
6 0
Michael camaro3318
04/24/2017 1:05 PM
Hall of Champions
1 0
Chris chris_mingus
04/24/2017 12:44 PM
Lost City (Specter)
There's a hidden chest on this screen.
0 0
Boygenius Kimbernichh
04/24/2017 11:30 AM
Clockwork Tower (Specter)
i do perfect parkour
3 0
DL413 darkmajora413
04/24/2017 9:43 AM
Tower of Fate (Specter)
This game is AMAZING !
5 0
otacon johnnyx97
04/24/2017 9:39 AM
Stranded Ship
0 0
Ben Elimanatoir
04/24/2017 9:34 AM
Village (Plague)
Succ
8 0
R.I.P. MV Fuego10
04/24/2017 5:19 AM
Plains (Specter)
The turtle rhino walked over to Black Knight cus he cares
1 0
R.I.P. MV Fuego10
04/24/2017 4:57 AM
Tower of Fate (Specter)
i steeled my resolve by watching a dancing person.makes sense.
7 0
<Cmac> cmac03
04/24/2017 4:27 AM
Pridemoor Keep (Specter)
Easily defeated
2 0
Rivet Gear DragonLord4444
04/24/2017 4:25 AM
Tower of Fate (Specter)
They should add body swap for the dlc story modes, am i right?
16 0
shadow p0kemonll22
04/23/2017 9:58 PM
Lost City (Specter)
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
7 0
Zeldroid ZELDA1989
04/23/2017 9:47 PM
Lost City (Specter)
wow this area looks beautifu.
4 0
Zeldroid ZELDA1989
04/23/2017 9:36 PM
Stranded Ship (Specter)
I wish that we could get polar knight DLC.
4 0
Mateo 2410SanJacinto
04/23/2017 7:58 PM
Explodatorium (Specter)
wubba lubba dub dub!
2 0
Dore superdore
04/23/2017 7:56 PM
Nave Varada (Specter)
q ago aqui no se
1 0
Connor PikaPika2000
04/23/2017 7:50 PM
Tower of Fate (Specter)
Okay. WHAT.
1 0
shadow p0kemonll22
04/23/2017 7:38 PM
The Lich Yard (Specter)
found the secret room
0 0
Ash CrazyAL86
04/23/2017 7:34 PM
Plains (Specter)
run on dem walls!!
2 0
Mateo 2410SanJacinto
04/23/2017 7:16 PM
Plains (Specter)
Man you ever wonder if eating the turkey makes specter night BONELY?!
3 0
Joshua SkyKing493
04/23/2017 7:13 PM
Explodatorium (Specter)
The Explodatorium's theme in Specter of Torment gets me so pumped and I love it.
0 0
Bludgeon Bludgeon
04/23/2017 7:10 PM
Tower of Fate (Specter)
This mode is awesome. Yacht Club Games be awesome!
6 0
Geeligan Geeligan_Stache
04/23/2017 7:03 PM
Memory of Adventure (Specter)
Polar Knight has the coolest stage so far!
0 0
Joey ju12zo
04/23/2017 6:30 PM
Clockwork Tower (Specter)
1 0
Noble pewdiepie559
04/23/2017 6:22 PM
Plains (Specter)
Just beat shovel knight....
4 0
KUNGFUSKA KUNGFUSKA
04/23/2017 6:20 PM
Torre del Hado (Specter)
5 2
Destiny DestinyIntwined
04/23/2017 6:12 PM
Plains (Specter)
1 0
Reivex11 Reivex11
04/23/2017 5:50 PM
Lost City (Specter)
Found the last skull. Cheeky hiding spot.
4 2
ant PikminAnthony
04/23/2017 5:15 PM
Tower of Fate (Specter)
specter knight looks really different in shovel knights playthrough
6 0
Calvin flaminfist01
04/23/2017 4:45 PM
Plains (Specter)
rip me
1 0
Eli Eliteshark19
04/23/2017 4:07 PM
Tower of Fate: Entrance (Specter)
~Uugh~! This is reeaallly difficult!
3 0
k'e flerk247
04/23/2017 3:27 PM
Explodatorium
ACHILLES
0 0
xerox xaviervideoguy19
04/23/2017 3:09 PM
Tower of Fate (Specter)
that's it?! 1700 gold?! I went through all that for 1700 gold?! welp, guess it's time to die now
7 0
Kenton FreakaJebus
04/23/2017 3:06 PM
Plains (Specter)
Woah dude.
6 0
emmanuel Meganuel
04/23/2017 3:04 PM
Campiña (Specter)
esto es cool
1 0
xerox xaviervideoguy19
04/23/2017 2:50 PM
Tower of Fate (Specter)
i have never wished for death more han this moment
4 0
Ben HouserClan
04/23/2017 2:33 PM
Plains (Specter)
Darkness? Will?? what are these things? I'm so excited to begin this new quest!
4 0
Michael MysteryGuy1412
04/23/2017 2:20 PM
Flying Machine (Specter)
Propeller Knight likes the air so I recommend bringing items that protect you from bottomless pits.
3 0
supersonic silvadow
04/23/2017 2:07 PM
Encounter - Baz
DEFINITELY good at art! Not...
1 0
Kyle º~º zwicharowski
04/23/2017 2:04 PM
Flying Machine
Ok...Shovel Knight Is A Good Game But MAN It Can Make You Rage!
7 0
Layton Necromancer2798
04/23/2017 2:00 PM
The Lich Yard
specter of torment changed this relic for me
1 0
Michael MysteryGuy1412
04/23/2017 1:41 PM
Tower of Fate: Entrance (Specter)
Fun Fact: If you need Black Knight to stay on the ground longer try using the Chronis Coin.
3 0
Tiddleybit Mr.Tiddleybits
04/23/2017 1:37 PM
Tower of Fate (Specter)
This is so much fun! I like this dlc way better than the first one!
4 0
Four eyes Blastbox22
04/23/2017 1:22 PM
Flying Machine (Plague)
There's a secret area in this room! It's a bit hard to see though...
1 0
Michael MysteryGuy1412
04/23/2017 1:16 PM
Pridemoor Keep (Specter)
Fun Fact: The Chronis Coin sub weapon is VERY effective against King Knight. Even better upgraded.
5 0
Four eyes Blastbox22
04/23/2017 1:06 PM
Shivering Sprint (Plague)
That wall's closing in fast! Start dashing and don't stop for anything!
0 0
Michael MysteryGuy1412
04/23/2017 1:03 PM
The Lich Yard (Specter)
Fun Fact: I simply just hate the upgraded Sentry sub weapon. Don't use it on me.
1 0
Putin Ace11621
04/23/2017 12:56 PM
Armor Outpost
im fast
1 0
me? sethio11
04/23/2017 12:38 PM
Tower of Fate (Specter)
(got scarlet back btw) reminded of plagueof shadows anyone
3 0
Vincent SpyroKing2468
04/23/2017 12:36 PM
Tower of Fate (Specter)
1 0
Gΐσ Brainz Gee-yogurt
04/23/2017 12:30 PM
Tower of Fate (Specter)
352 5
Michael MysteryGuy1412
04/23/2017 12:10 PM
Clockwork Tower (Specter)
Highly recommend using Judgement Rush on Tinker Knight. Works on both forms too!
2 0
Kyalani Kikiki55
04/23/2017 11:49 AM
Plains (Plague)
0 0
Hayden97 haydengold97
04/23/2017 11:21 AM
Pridemoor Keep (Specter)
4 0
Ben TriforceofPie
04/23/2017 11:16 AM
Clockwork Tower (Specter)
that scrolling tower was soooo hard
1 0
Leo LeonardoNunez
04/23/2017 11:01 AM
Tower of Fate (Specter)
This was awesome! I'm ready for King Knight next!
2 0
Nix brony417
04/23/2017 10:32 AM
Clockwork Tower (Specter)
Almost done with spectre of tounament :)
2 0
Yeah BatFan88
04/23/2017 10:07 AM
Pridemoor Keep
Breaking all the checkpoints
2 0
radblaster scoobydoobydont
04/23/2017 10:06 AM
Tower of Fate (Specter)
we are... youtube comments. we like ... your meme ... we like ... your ponies
8 0
Brielle brielle2065
04/23/2017 9:53 AM
Plains (Plague)
Playing as Plague knight. Wish me luck on my adventure!!
0 0
Yeah BatFan88
04/23/2017 9:48 AM
Plains
Trying not to get any gold is very stressful
2 0
me? sethio11
04/23/2017 9:34 AM
Plains (Specter)
tryingto do the no damage feat and im so scared!
1 0
Jay Jaytr0n
04/23/2017 9:20 AM
Plains (Specter)
I love this new update!
7 0
buddycullm buddycull
04/23/2017 9:14 AM
Tower of Fate: ???? (Specter)
I hate the enchantress!!!!
10 0
Ryan BS_Alliance
04/23/2017 8:49 AM
The Lich Yard (Specter)
im falling!!!!!!!!!!!!!!!!!!!!!!'!!!!
1 0
Ryan BS_Alliance
04/23/2017 8:43 AM
The Lich Yard (Specter)
holy s**t this litch yard is crazy
0 0
Ryan BS_Alliance
04/23/2017 8:41 AM
Tower of Fate (Specter)
i must murder you all!
8 0
Ryan BS_Alliance
04/23/2017 8:40 AM
Tower of Fate (Specter)
wahhhh! give me more money!
2 0
Ryan BS_Alliance
04/23/2017 8:39 AM
Tower of Fate (Specter)
can i get more of these?
1 0
Ryan BS_Alliance
04/23/2017 8:37 AM
Tower of Fate (Specter)
am i good or bad?
2 0
Ryan BS_Alliance
04/23/2017 8:36 AM
Tower of Fate (Specter)
can i get aaaaaany credit? enchantress?
3 0
Ryan BS_Alliance
04/23/2017 8:33 AM
Tower of Fate (Specter)
this music reminds me of o'l shovel'o hope
1 0
Putin Ace11621
04/23/2017 8:30 AM
Plains
lolz
1 0
Neon Kurichan0219
04/23/2017 8:25 AM
Pridemoor Keep (Plague)
Tvsvueio all caps
4 0
Ryan BS_Alliance
04/23/2017 8:13 AM
Clockwork Tower (Specter)
i've got all the red skulls
3 0
brayden rocket5454
04/23/2017 8:11 AM
Encounter - Phantom Striker
FIGHT ME!
0 0
Ryan BS_Alliance
04/23/2017 8:10 AM
Clockwork Tower (Specter)
yes m'am!
0 0
Ryan BS_Alliance
04/23/2017 8:09 AM
Clockwork Tower (Specter)
just get the knights already!
0 0
Ryan BS_Alliance
04/23/2017 8:08 AM
Clockwork Tower (Specter)
0 0
Ryan BS_Alliance
04/23/2017 8:02 AM
Lost City (Specter)
i think they might be making king knight his own adventure!
2 1
Ryan BS_Alliance
04/23/2017 8:01 AM
Lost City (Specter)
im right on mole knight
2 0
Jay Bethea_Carolina
04/23/2017 7:53 AM
Stranded Ship (Specter)
i love this
2 0
jack wiithedigs
04/23/2017 7:27 AM
Plains
nnnnaaaaaahhhh
4 0
nicholas megapizzaman
04/23/2017 7:18 AM
Plains
Just havin a pillow fight with my gal black knight
4 0
Odin odinkirby
04/23/2017 7:05 AM
Plains (Specter)
I JUST ATE TURKY BONES!
4 0
k'e flerk247
04/23/2017 7:05 AM
Flying Machine (Specter)
3 0
Rivet Gear DragonLord4444
04/23/2017 6:44 AM
Clockwork Tower
Used a cheat code for all items and upgrades and i feel no regret
2 0
me? sethio11
04/23/2017 6:10 AM
Pridemoor Keep (Plague)
[insert bbt secret song here]
0 0
William frigogin
04/23/2017 5:55 AM
Tower of Fate (Specter)
2 0
Bubba bubbaj606
04/23/2017 5:48 AM
Pridemoor Keep (Specter)
King knight is a pain!
2 0
Omega BroHam246
04/23/2017 5:26 AM
Tower of Fate (Specter)
Not worth it... but it is VERY fun
6 0
Omega BroHam246
04/23/2017 4:56 AM
Plains (Plague)
Easy peasy lemon sueezy
2 0
Gold fredbear2003
04/23/2017 2:01 AM
Flying Machine
the electric jellyfish are like hell to get past
0 0
CJ fuzzycupcake6
04/22/2017 11:31 PM
Pridemoor Keep (Specter)
easter egg to the left of pridemoor keep!!
7 0
Lэgő ijя Nx1e6oxN
04/22/2017 9:16 PM
Torre del Hado (Specter)
the minigame is so hard
7 0
Blitz omarisonic
04/22/2017 8:46 PM
Tower of Fate (Specter)
i has a cat
2 0
Dore superdore
04/22/2017 8:40 PM
Plains (Specter)
q buen juego en 8 vits
0 0
gavin gavin519
04/22/2017 7:25 PM
Tower of Fate: ???? (Plague)
dark link knock off
1 0
littleqman littleqman
04/22/2017 7:17 PM
Tower of Fate: ???? (Specter)
total fare
6 0
knight phatcatt209
04/22/2017 6:59 PM
Clockwork Tower (Specter)
4 0
Ryan BS_Alliance
04/22/2017 6:54 PM
Tower of Fate (Specter)
i love specter of torment sooooooo much!!!!!!
2 0
lorno krupintupple
04/22/2017 6:42 PM
Explodatorium (Specter)
i beat a boss. yub.
6 0
NoahHeroic NoahRocker6823
04/22/2017 6:42 PM
Explodatorium (Specter)
NOPE
2 1
Dekgear juanpablo94
04/22/2017 6:37 PM
Plains (Specter)
es una tortuga o un rino :0
2 0
NoahHeroic NoahRocker6823
04/22/2017 6:35 PM
Plains (Specter)
I USED SPIDER SCYTHE TO BEAT BLACK KNIGHT!
0 0
Ryan zygardecrunchypb
04/22/2017 6:26 PM
Tower of Fate (Specter)
curio upgrades, dragon man, and chest cat, i think this room is my personal favorite.
3 0
pokemon marioman12369
04/22/2017 6:13 PM
Tower of Fate (Specter)
just beat the minigame
0 0
lorno krupintupple
04/22/2017 6:07 PM
Explodatorium (Specter)
i died. again.
2 0
Nicky Tackle_Monster
04/22/2017 4:59 PM
Tower of Fate (Specter)
2 0
tj'sgreat tjsgreat
04/22/2017 4:46 PM
Tower of Fate (Specter)
now im off to fight the enchantress who is suprisingly sheild knight
3 0
patience rbelivo
04/22/2017 4:46 PM
The Lich Yard
that was hard as hell in multiplayer
2 0
NoahHeroic NoahRocker6823
04/22/2017 4:41 PM
Tower of Fate: ???? (Specter)
Donovan: reize! (BOSS BATTLE: NIGHTMARE REIZE)
0 0
NoahHeroic NoahRocker6823
04/22/2017 4:36 PM
Tower of Fate: ???? (Specter)
Donovan: huh... the face of the enchantress is on!
5 0
Squeakers Erik2014
04/22/2017 4:21 PM
Lost City (Specter)
Who else thinks Plague Knight is the best?
5 0
NoahHeroic NoahRocker6823
04/22/2017 4:20 PM
Tower of Fate: ???? (Specter)
Beat Him. Beat The Game. I Became A Knight Of The ORDER OF NO QUARTER!
3 0
NoahHeroic NoahRocker6823
04/22/2017 4:19 PM
Tower of Fate: ???? (Specter)
OH MY GOSH HE IS SO HARD
1 0
isaac omgods
04/22/2017 4:19 PM
Tower of Fate: ???? (Specter)
skate or die. either you skate or you die.
5 0
NoahHeroic NoahRocker6823
04/22/2017 4:17 PM
Tower of Fate: ???? (Specter)
I used Judgement Rush and it pulled me under the blocks!!!
3 0
Squeakers Erik2014
04/22/2017 4:16 PM
Tower of Fate (Specter)
Hee hee hee! Hello there people!
2 0
JfWood catocat9001
04/22/2017 4:14 PM
Tower of Fate (Specter)
WOOOO NEW GAME MODE!!!!
4 0
Marcy WolvesRule123
04/22/2017 4:08 PM
Clockwork Tower (Specter)
I love this music!
1 0
loltrollol xdash153
04/22/2017 4:07 PM
Tower of Fate (Specter)
playon tower of fate boyyy hangin here with my boy reite
3 2
trey newtreyman
04/22/2017 3:50 PM
Hall of Champions (Plague)
they put arin omg
1 0
LoreSoul LoreSoul
04/22/2017 3:35 PM
Tower of Fate (Specter)
this is an awesome.....dlc i guess <3
2 0
Golden CaterpieisLife
04/22/2017 3:34 PM
Stranded Ship
any tips for pola knight
0 0
Hayden dirtohana
04/22/2017 3:27 PM
Pridemoor Keep (Specter)
0 0
Gabe Dude1002746
04/22/2017 3:24 PM
Tower of Fate (Specter)
King knight more like kink knight!!!!!!!
4 0
Kaizoku KaizokuFighter
04/22/2017 3:24 PM
Flying Machine (Specter)
Complete this level? No thanks. I'd rather listen to its theme song. =p
3 3
KC Kcondori
04/22/2017 3:18 PM
Tower of Fate (Specter)
Propeller Knight remains! One more go!
2 0
juliane Julianeithor
04/22/2017 3:16 PM
Campiña
que cool es jugar de adobles
1 0
Rohan Rohni314
04/22/2017 3:11 PM
Tower of Fate (Specter)
Best Buds
0 0
shadow p0kemonll22
04/22/2017 2:41 PM
Plains
wooooo bodyswap mode
2 0
pakupaku pdbz199
04/22/2017 2:29 PM
Pridemoor Keep
2 0
Andre anybica
04/22/2017 2:04 PM
Flying Machine
i hate this guy so much. He deserves to die
1 0
Donut Dude Nehpets44
04/22/2017 1:46 PM
Plains (Specter)
dude im so higgledy-piggledy
0 0
Ichigo ichigo103
04/22/2017 1:41 PM
Village
1 0
Billy billbrad
04/22/2017 1:07 PM
Lost City (Specter)
i need to get moar skulls
1 0
Cactus Butterlover726
04/22/2017 1:04 PM
Tower of Fate (Specter)
kinda blown away honestly. cant wait for king knight!
0 0
Lucas LucasG05
04/22/2017 12:42 PM
Explodatorium (Specter)
i keep losing!
1 0
Austin taylorfox123
04/22/2017 12:37 PM
Clockwork Tower
I JUST WANT TO MURDER THIS GAME ................ BUT I CANT CAUSE I LOVE IT
1 0
Cooky.C Cookycunstrukter
04/22/2017 12:26 PM
Tower of Fate (Specter)
has anyone else make it to the top of the minigame?
3 0
Eleven FalcawnPunch
04/22/2017 12:21 PM
The Lich Yard (Specter)
0 0
Austin taylorfox123
04/22/2017 12:09 PM
Clockwork Tower
0 0
Daisy ZemnDragon
04/22/2017 11:53 AM
Tower of Fate (Specter)
6 0
Dewbee D3WB33
04/22/2017 11:40 AM
The Lich Yard
3 0
Lambda coolguy33
04/22/2017 11:33 AM
Tower of Fate: Entrance (Specter)
2SPOOPY5ME
5 0
BT-Sans megalovania99
04/22/2017 11:17 AM
Plains (Specter)
sp&johny lets you play as donovan
3 0
Zach sanic55555
04/22/2017 11:03 AM
Stranded Ship (Specter)
aww yis
1 0
Daniel PixelBoy16
04/22/2017 10:25 AM
Tower of Fate: ???? (Specter)
I just finished the game 100% and got the best armor and curio EVER!
14 0
D-Man Frinpollog
04/22/2017 10:18 AM
Village
Unfortunately the new amiibo character still won't take regular amiibos. Sad.
2 0
pokemaster Gcward
04/22/2017 9:42 AM
Troupple Pond (Plague)
new mode yay
3 0
PI–roject TheProjectZ
04/22/2017 9:32 AM
Tower of Fate (Specter)
good vidja
1 0
Donnie Donniemonster19
04/22/2017 9:17 AM
Plains
new
1 0
Callum Calimari969
04/22/2017 9:15 AM
Tower of Fate: Entrance (Specter)
db
7 0
jm667_YTU 834068
04/22/2017 9:14 AM
Máquina Voladora (Specter)
una actualización genial
3 0
Brandon tricat3
04/22/2017 8:33 AM
Flying Machine (Plague)
i hated the airship level as shovelknight i hate it as plagueknight and ill hate it as specterknight
0 0
Ethan Ethan_5972
04/22/2017 8:30 AM
Tower of Fate (Specter)
BEST DOG EVER
1 0
MaxMaxDude ProfessorPotato3
04/22/2017 8:14 AM
Plains
poop
2 0
JoyStick ShadowFlame100
04/22/2017 8:11 AM
Tower of Fate (Specter)
2 0
Nick mohawksrule129
04/22/2017 7:50 AM
Tower of Fate: Entrance (Specter)
6 0
Marq young-peezy
04/22/2017 6:40 AM
Plains
be in my team
3 1
Ryan zygardecrunchypb
04/22/2017 6:39 AM
Plains (Specter)
new game plus makes bosses a joke, but normal stages a pain in the butt
1 0
Ryan zygardecrunchypb
04/22/2017 6:36 AM
Plains (Specter)
New game plus, run before you die
2 0
Reid Soggyguy
04/22/2017 6:26 AM
Plains
tftxpkppbv@'
0 0
Ryan zygardecrunchypb
04/22/2017 6:10 AM
The Lich Yard (Specter)
Darn you plaque knight, this is a personal place for spector knight
5 0
old jack jackmrowe
04/22/2017 6:02 AM
Plains (Specter)
1 0
Layton Necromancer2798
04/22/2017 5:25 AM
Pridemoor Keep (Specter)
how could i forget about this room?
3 0
Gargola64 gargola64
04/22/2017 5:12 AM
Explodatorium (Specter)
There is a double or triple plauge knight on the plauge knight boss
1 0
KJR K3v1nR3y3s
04/22/2017 5:12 AM
Peacetime Climb
This is quite challenging...
1 0
b braden18
04/22/2017 4:54 AM
Plains
0 0
me? sethio11
04/22/2017 4:13 AM
Tower of Fate (Specter)
i love my reflection
3 0
Arcblaze arcblazegaming
04/22/2017 3:44 AM
Hall of Champions
best excrcrost
0 0
Arcblaze arcblazegaming
04/22/2017 2:13 AM
The Lich Yard
stragity for specter knight?
2 0
ian Legofan456321
04/22/2017 1:51 AM
Tower of Fate (Specter)
i got this free yay
4 0
supersonic silvadow
04/22/2017 1:40 AM
Tower of Fate (Specter)
minute
4 0
supersonic silvadow
04/22/2017 1:39 AM
Tower of Fate (Specter)
I THINK I might of just found a secret flashback level after continuing to stare at the moon for 1
2 1
derek dmanrex
04/22/2017 12:11 AM
Pridemoor Keep (Plague)
i hate those ratcopters
0 0
GewdTwo GewdTwo
04/21/2017 11:58 PM
Tower of Fate (Specter)
infinidagger!! spectre knight is my fav!
5 0
βυsτέг Richie
04/21/2017 11:36 PM
Tower of Fate (Specter)
Gems. Gems and an achievement. I think I need to take a break before I go insane.
4 0
SUPER BEN stjoeleo
04/21/2017 11:17 PM
Iron Whale
what is with nintendo and fire underwater
3 0
nickybear poplata
04/21/2017 10:15 PM
Village
genderbent proppeler knight is making me feel feelings i never wanted to feel about proppeler knight
4 0
liem L-GUY1
04/21/2017 9:55 PM
Tower of Fate (Specter)
specter knight is awesome forget you plague knight!JK plague is#2 shovel is#3 specter is#1 in my opi
3 0
TOPolk TOPolk
04/21/2017 9:21 PM
Plains (Specter)
Back to action!
2 0
SUPER BEN stjoeleo
04/21/2017 9:13 PM
Explodatorium
such stress such mad always time for doge puns
0 0
Andrew SpeedRunner2015
04/21/2017 8:52 PM
Tower of Fate (Specter)
I forgot this was even a thing. HELLOOOO! INFINIDAGGER! Other Game Grumps references!
7 0
River riverk1234
04/21/2017 8:51 PM
Plains (Specter)
what
0 0
NoahHeroic NoahRocker6823
04/21/2017 8:47 PM
Tower of Fate (Specter)
Meet Pig, A Part Of Animal Sponsors!
4 0
Greg BrazenPrune
04/21/2017 8:17 PM
Village (Plague)
Yay plague knightin!
3 0
Cam traydfull
04/21/2017 8:06 PM
Tower of Fate (Specter)
the guy who kisses you and failed actaully can succed
1 0
Cam traydfull
04/21/2017 8:04 PM
Tower of Fate (Specter)
eveuntaly the gold armor dude loses his helmet and has a dragon head
1 0
Trin TrinRaw120
04/21/2017 7:47 PM
Tower of Fate (Specter)
Wow! I feel so fired up after fighting. And he seems kinda cooler than before.
3 0
Ethan thesmiths
04/21/2017 7:44 PM
Tower of Fate: Ascent
i've been here for TWO HOURS trying to beat this on new game plus. not even mad, just really bored.
2 0
Monkey Hernanco
04/21/2017 7:43 PM
Plains
1 0
Kaleb Lt.Gargonshnoff
04/21/2017 7:39 PM
Tower of Fate (Specter)
After waiting a year it's finally come!
2 0
isaiah jennykate77
04/21/2017 4:50 PM
Plains
did anyone else beat the game as shovel knight and re-play it gender swapped
3 0
MrChance randomchance
04/21/2017 4:47 PM
Plains (Specter)
The turtle laughs too!
3 0
MrChance randomchance
04/21/2017 4:45 PM
Plains (Specter)
I'm uncommon
4 0
MrChance randomchance
04/21/2017 4:39 PM
Plains (Specter)
Just ate turkey bones
5 0
MrChance randomchance
04/21/2017 4:38 PM
Plains (Specter)
I'm gonna miss Miiverse
4 0
MrChance randomchance
04/21/2017 4:35 PM
Plains (Specter)
A time to reap
1 0
Wolfy YT Dyson_And_Cleo
04/21/2017 4:12 PM
Plains (Specter)
OMG I just somehow survived...
3 0
Luke Luketwnsnd
04/21/2017 4:10 PM
Pridemoor Keep (Specter)
3 0
Galax 7777 Galax7777
04/21/2017 3:53 PM
Recuerdo de conflicto (Specter)
sheld knite
0 0
awesome awesome_man2006
04/21/2017 3:52 PM
The Lich Yard (Plague)
This level is stupid! STOP WITH THE THING WHERE YOU CAN'T SEE CRUD.
2 0
Fenner fennaynays
04/21/2017 3:42 PM
Tower of Fate (Specter)
wait in the noir color palette after you defeat a knight for secret levels
1 0
Fenner fennaynays
04/21/2017 3:30 PM
Tower of Fate (Specter)
this is better than shovel knight
2 0
buddycullm buddycull
04/21/2017 3:03 PM
Tower of Fate (Specter)
I am specter knight, hear me DIE!!!!!
3 0
Brian BCWerewolf
04/21/2017 2:58 PM
The Lich Yard (Specter)
specter update is awesome!
5 0
Galax 7777 Galax7777
04/21/2017 2:49 PM
La Ciudad Perdida (Specter)
0 0
Clowkero Clowkero
04/21/2017 2:48 PM
Tower of Fate (Specter)
34 0
Pluis Hioer42
04/21/2017 2:46 PM
The Lich Yard (Specter)
<-- TREASURE THIS WAY IF YOU DARE
4 0
Skygamer Royal_Glacial
04/21/2017 2:43 PM
Pridemoor Keep (Specter)
3 0
Pluis Hioer42
04/21/2017 2:38 PM
The Lich Yard (Specter)
BEST REMIX!
7 1
NoahHeroic NoahRocker6823
04/21/2017 2:21 PM
Troupple Pond (Plague)
OMG
0 0
Murf Blackie2414
04/21/2017 2:08 PM
Plains (Specter)
Sorry Switch, gotta come back to the Wii U one last time...for shovelry!
5 0
Pablo PabloLupas
04/21/2017 2:07 PM
Campiña
juh
2 0
NoahHeroic NoahRocker6823
04/21/2017 2:05 PM
Armor Outpost
Shantae Knight: ...
1 0
Nate IBeTrollin
04/21/2017 2:04 PM
Tower of Fate (Specter)
After a month of resisting the urge to buy the Switch version, Specter Knight is finally here!!
11 0
€®Vϊñçéňт VJOSmith9
04/21/2017 1:47 PM
Plains (Plague)
is there any other story lines than plauge, shovel, and scythe
0 0
andrew amd638
04/21/2017 1:45 PM
Village
this game ie life
2 0
jaden jadenhmb
04/21/2017 1:43 PM
Plains (Plague)
i cant beat the first level in plauge night mode
0 0
Alfonso pikminology101
04/21/2017 1:22 PM
Tower of Fate (Specter)
This is too great! Look at the doggy go!!
3 0
Core TheCore59
04/21/2017 1:06 PM
Plains
2 player some how makes the game better than what it already is
6 0
NoahHeroic NoahRocker6823
04/21/2017 12:51 PM
The Lich Yard
please reply. CAN ANYONE HELP ME WITH THIS ROOM!? IM STUCK AND I DONT KNOW WHERE I COULD GO!!!
0 1
NoahHeroic NoahRocker6823
04/21/2017 12:43 PM
Encounter - Black Knight
That Coward Doesnt beat me.
0 0
NoahHeroic NoahRocker6823
04/21/2017 12:42 PM
Encounter - Black Knight
TAKE THIS (Uses Dust Knuckles)
2 0
NoahHeroic NoahRocker6823
04/21/2017 12:40 PM
Encounter - Black Knight
IS THAT CHAOS LORD XENO!?
0 0
Colemine link2004island
04/21/2017 12:39 PM
Tower of Fate (Specter)
So happy they added specter of torment! Specter knight is my favorite character!
8 0
ebay Nico_Guy3
04/21/2017 12:03 PM
Plains
how does one do multiplayer
4 2
Juron Pilo JuronP
04/21/2017 11:21 AM
Plains (Specter)
hi all love this game
1 0
Forgotten forgotten1103
04/21/2017 11:11 AM
Plains (Specter)
dis iz harderst vurzyun
4 0
David dbtdwt
04/21/2017 7:14 AM
Tower of Fate (Specter)
3 1
Traceman Traceman
04/21/2017 6:48 AM
Plains (Specter)
Honestly I'm torn I have no Idea witch of the 3 campaigns I like better because they're all good
3 0
David dbtdwt
04/21/2017 6:30 AM
Tower of Fate (Specter)
Cool! Scythe surfing!
3 0
Matthew Bradyface999
04/21/2017 6:29 AM
Troupple Pond
i am watching a derpy whale made out of apples do synchronized swimming with a bunch of apple fish:$
4 0
Devon dap53214
04/21/2017 6:10 AM
Iron Whale
Break the blocks with the shells.
1 0
epiphyte epiphyte
04/21/2017 5:06 AM
Tower of Fate (Specter)
None shall defy me.
2 0
me? sethio11
04/21/2017 4:28 AM
Tower of Fate (Specter)
It is time for another I N F I N I D A G G E R A D V E N T U R E
7 0
bigcrumbs BIGCRUMBS
04/21/2017 2:29 AM
Tower of Fate (Specter)
LOVE SHOVEL KNIGHT
3 0
Escargo Escargo
04/21/2017 2:11 AM
Tower of Fate (Specter)
Give the cat a pink ball for money
3 0
Escargo Escargo
04/21/2017 2:10 AM
Tower of Fate (Specter)
Hit the mirror
0 0
Escargo Escargo
04/21/2017 2:06 AM
Tower of Fate (Specter)
Break the gargoyle
5 0
Nick SoupahMario
04/21/2017 1:09 AM
Plains (Specter)
The "Yeah!" button is "Verily!", Yacht Club, I am in love with everything you do.
5 0
Nick SoupahMario
04/21/2017 12:48 AM
Plains
Whoa, this is neat! Miiverse functionality! Hello my fellow diggers!
6 0
Michael MysteryGuy1412
04/21/2017 12:45 AM
Plains (Specter)
Awake at almost 3 AM and just realized Spector of Torment finally came out for the Wii U. FINALLY!
5 0
Wesley GorohKirby
04/21/2017 12:33 AM
Plains (Specter)
Nothin' better than free DLC!
9 0
Wesley GorohKirby
04/21/2017 12:25 AM
Village
3 0
Cruz Cruzfire21
04/21/2017 12:17 AM
Iron Whale
Just finished spector of torment in one sitting Ahhhhhhh
6 0
Sinclair Vegeta777OMG
04/20/2017 11:49 PM
Armería
No quiero incomodar a nadie pero vendo empanadas :v
2 0
xXPyroXx sackboy2005
04/20/2017 10:35 PM
Tower of Fate (Specter)
my bum hurts
0 0
J hover11
04/20/2017 10:27 PM
The Lich Yard (Specter)
I'm Specter Knight and this is my crib. (Insert MTV Crib Intro Here)
8 5
J hover11
04/20/2017 9:50 PM
Plains (Specter)
I fell down a hole and died. How is that even possible? Im already dead!
7 0
Four eyes Blastbox22
04/20/2017 9:08 PM
Lost City (Plague)
Even while in a rush, you still have Cipher Coins to collect! Break those blocks!
0 0
NoahHeroic NoahRocker6823
04/20/2017 8:58 PM
Lost City (Specter)
Donovan Wins!
1 0
NoahHeroic NoahRocker6823
04/20/2017 8:58 PM
Lost City (Specter)
Specter Knight: dont rush at me. mole knight: i did.
1 0
Ethan thesmiths
04/20/2017 8:54 PM
Tower of Fate: Entrance (Specter)
I HATE THIS SECTIOn
3 0
NoahHeroic NoahRocker6823
04/20/2017 8:36 PM
Explodatorium (Specter)
Specter Knight: told you. Plague Knight: ugh...
0 0
NoahHeroic NoahRocker6823
04/20/2017 8:35 PM
Explodatorium (Specter)
Specter Knight: your completed as your own! Plague Knight: ...i dont care...
0 0
NoahHeroic NoahRocker6823
04/20/2017 8:33 PM
Explodatorium (Specter)
Specter Knight: interesting... i should fall...
3 0
NoahHeroic NoahRocker6823
04/20/2017 8:26 PM
Tower of Fate: Entrance
Steel Thy Boomerang!
1 0
$N1PÄRZ 4321mario1
04/20/2017 8:21 PM
Tower of Fate (Specter)
Just got Specter Knight, having a blast!
4 0
awesome awesome_man2006
04/20/2017 8:06 PM
Plains (Plague)
Wow, this is easier than the normal campaign.
3 0
NoahHeroic NoahRocker6823
04/20/2017 7:59 PM
Clockwork Tower (Specter)
HOW AM I SUPPOSED TO GET PAST THIS AS DONOVAN!?
1 0
supersonic silvadow
04/20/2017 7:54 PM
Plains (Specter)
gerinherthumbandtheshapeofanlonherforehead
2 1
supersonic silvadow
04/20/2017 7:53 PM
Plains (Specter)
Somebodyoncetolmetheworldwasgonnarollmeiaintthesharpesttoolintheshedshewaslookingkindadumbwithherfin
3 0
NoahHeroic NoahRocker6823
04/20/2017 7:30 PM
The Lich Yard (Specter)
Oh, The Ivory.
1 0
NoahHeroic NoahRocker6823
04/20/2017 7:21 PM
Plains (Specter)
IM A REAPER
3 0
NoahHeroic NoahRocker6823
04/20/2017 7:07 PM
Troupple Pond
ALL FIGHT THE TROUPPLE KING WITH FIRE
1 0
NoahHeroic NoahRocker6823
04/20/2017 7:04 PM
Troupple Pond
TROUPPLE KING (King Of The Troupples!)
2 0
NoahHeroic NoahRocker6823
04/20/2017 7:01 PM
Plains
OMG SHANTAE KNIGHT BEAT REIZE KNIGHT
3 0
Danny megalanzero
04/20/2017 6:57 PM
Plains (Specter)
3 0
NoahHeroic NoahRocker6823
04/20/2017 6:51 PM
Explodatorium
Shantae Knight Wins!
1 0
NoahHeroic NoahRocker6823
04/20/2017 6:50 PM
Explodatorium
Shantae Knight VS Witch Knight! OMG
0 0
KC Kcondori
04/20/2017 6:43 PM
Tower of Fate (Specter)
Specter of Torment is AWESOME!
7 0
Ethan thesmiths
04/20/2017 6:35 PM
Lost City (Specter)
here's the lost city i know
7 0
NoahHeroic NoahRocker6823
04/20/2017 6:32 PM
Plains (Specter)
Specter Knight: This seems interesting...
2 0
NoahHeroic NoahRocker6823
04/20/2017 6:31 PM
Tower of Fate (Specter)
???: Hello, everyone. i am specter knight.
1 0
Mattoo HeroOfPenguins
04/20/2017 6:30 PM
Tower of Fate (Specter)
Why does Reize call you an underling and a puppet if you beat him
14 3
NoahHeroic NoahRocker6823
04/20/2017 6:27 PM
Tower of Fate (Specter)
???: I know its hard sometimes...
0 0
p00na3e p00na3e
04/20/2017 6:23 PM
Hall of Champions (Plague)
LOL ARIN
0 0
supersonic silvadow
04/20/2017 6:05 PM
Plains
H0i!
3 0
jesse jamguy1013
04/20/2017 5:55 PM
Explodatorium (Specter)
1 0
littleqman littleqman
04/20/2017 5:46 PM
The Lich Yard (Specter)
memes
2 0
Ethan thesmiths
04/20/2017 5:44 PM
Plains (Specter)
HYPE
3 0
Jeannie epicpokemaniac
04/20/2017 5:18 PM
Tower of Fate (Specter)
Gotta love that view. It gets even better with each Knight you recruit!
3 0
IceWalkerº deletro
04/20/2017 4:58 PM
Tower of Fate (Specter)
Give gold to the cat-pedastal to get a color swap
18 0
Emanuel TheNintendbro
04/20/2017 4:57 PM
Plains (Specter)
Guys, im so excited that it came out! This is gonna be so good!
3 0
Peedee :) EmberEagle
04/20/2017 4:44 PM
Plains (Specter)
Day 1: I have been tasked by Enchantress to create a league of knights. My reward: my mortality.
4 0
El Ray GREENRAYGE
04/20/2017 4:23 PM
Plains (Specter)
Awesome! Lets do this.
0 0
Dj BaptisteWU
04/20/2017 4:18 PM
Plains (Specter)
We're here.
4 1
Kana flame-bb
04/20/2017 3:34 PM
Plains (Specter)
first time
1 0
DeathG death6457
04/20/2017 3:24 PM
Clockwork Tower (Specter)
Specter/Spectre of Torment hype!!!!!!!!
3 0
Neditios Neditios
04/20/2017 3:19 PM
Memory of Conflict (Specter)
Welp, RIP those three.
0 0
littleqman littleqman
04/20/2017 3:05 PM
Explodatorium (Specter)
yo welcome to my mvp crib
4 0
Dave Davidini
04/20/2017 2:19 PM
Pridemoor Keep
Dance!
4 0
nes class Stormsas
04/20/2017 12:55 PM
Plains
CO OP is in the GAME!!!
5 0
cochito ASOMBROZO
04/20/2017 12:45 PM
Campiña (Specter)
esto esta dificil (this is hard)
1 0
cochito ASOMBROZO
04/20/2017 12:23 PM
Campiña (Specter)
better than spider-man
3 0
cochito ASOMBROZO
04/20/2017 12:18 PM
Campiña (Specter)
shovel knight rifa
0 0
paulbbalin Smartguy63
04/20/2017 9:32 AM
Explodatorium
rats are evil!
1 0
Toko ShesChaos
04/19/2017 8:55 PM
Iron Whale
training for specter knight with thy shovel of glory!
4 0
Rowan Ben. rowan.bentley
04/19/2017 7:22 PM
Cog Bounce Chaos
I DIED AT THE END *bleep*
0 0
fireblast Fireblast007
04/19/2017 5:06 PM
Village
What is the best way to grind $?
0 1
aturisk pavdad
04/19/2017 5:03 PM
Pridemoor Keep
yeah best game ever
0 0
Big Daddy hughesfamilywii
04/19/2017 3:55 PM
Stranded Ship
2 0
Wallrun liambp
04/19/2017 3:00 PM
Village
Hi
3 0
Galax 7777 Galax7777
04/19/2017 12:56 PM
Mansión de los Campeones
goddamit ross
0 0
Galax 7777 Galax7777
04/19/2017 12:21 PM
Explotatorium
0 0
Connor nanason
04/19/2017 8:14 AM
Pridemoor Keep
1 0
Lucho lucho72
04/19/2017 6:51 AM
Plains
at the end of the game shovle knight marries sheld knight
5 0
Lucho lucho72
04/19/2017 6:47 AM
Plains
3 0
paulbbalin Smartguy63
04/18/2017 8:03 PM
Lost City
well im exited for friday
5 0
Soysal5000 SirSalahad
04/18/2017 6:20 PM
Explodatorium
2 0
2Cents 2centsmartypants
04/18/2017 5:25 PM
Flying Machine (Plague)
Use Vats to get to a familiar secret.
2 0
Kasten Spikedpikmin
04/18/2017 5:10 PM
Pridemoor Keep
Aaaaaaaaaaaaaaaaaaaaaaaaaaaa
1 0
Garrett GTSchrader
04/18/2017 5:09 PM
Plains
1 0
littleqman littleqman
04/18/2017 4:26 PM
Rematch: King Knight
high
0 0
littleqman littleqman
04/18/2017 4:21 PM
Rematch: King Knight
ahhhhhhh
0 0
Austin taylorfox123
04/18/2017 4:00 PM
Lost City
2 0
Quinn MightyNoodle
04/18/2017 3:50 PM
Pridemoor Keep
how
0 0
Corrian kelloggs572
04/18/2017 3:29 PM
Explodatorium
2 0
Stephen YoshisNentendo
04/18/2017 1:01 PM
Plains
Did a speedrun of the tutorial. no food. :)
0 0
cody markalbarran2787
04/18/2017 10:42 AM
Iron Whale
1 0
2Cents 2centsmartypants
04/18/2017 3:02 AM
The Lich Yard (Plague)
Can't figure out how to get to top left
3 0
Kai ng33k01
04/17/2017 2:48 PM
Troupple Pond
0 0
Abel sunlight01
04/17/2017 12:21 PM
Tower of Fate: ????
3 0
KC Kcondori
04/17/2017 11:06 AM
Iron Whale
0 0
Colemine link2004island
04/17/2017 10:00 AM
Troupple Pond
The trouple kings dance is ADORABLE!
1 0
Colemine link2004island
04/17/2017 3:26 AM
Village
I was listening to the specter knight theme. Best song in the game!
3 0
Mario DavisBrosWiiU
04/16/2017 9:28 PM
Pridemoor Keep
SHOVEL READY
3 0
WESTIC TECTRU
04/16/2017 9:00 PM
Explotatorium
Lo huviera logrado a la primera, pero llege hasta el con un punto de vida
0 0
alice wolo08
04/16/2017 7:58 PM
Village
1 0
alice wolo08
04/16/2017 7:05 PM
Troupple Pond
1 0
Cassandra Umbrepom
04/16/2017 6:45 PM
Iron Whale
im screamin theres no checkpoint anywhere before the angler in new game plus im...,.dead
0 0
Jude jude1337
04/16/2017 4:55 PM
Plains
hi im boris the wolf
0 0
caseus dragonbonofdoom
04/16/2017 3:36 PM
Rematch: King Knight
when is specter knight coming-out
0 0
Ash Ash_Dilan
04/16/2017 11:10 AM
Explodatorium
The freaking fire jumps are stupidly hard!
2 0
??? kirbykid2
04/16/2017 10:19 AM
Village
oooooooooo I'm a ghost boo
6 0
Zack zack700
04/16/2017 9:41 AM
Flying Machine
Whos your favorite wandering travler mines mr hat.
1 0
Ash Ash_Dilan
04/16/2017 9:35 AM
Explodatorium
Jeez. This game is hard.
2 0
chib mic durainman
04/16/2017 7:15 AM
Pridemoor Keep
2 0
Toonlink77 childers04
04/16/2017 6:16 AM
Clockwork Tower (Plague)
1 0
John TheJBROCKZ
04/15/2017 7:29 PM
Pridemoor Keep
Yeet
0 0
John TheJBROCKZ
04/15/2017 7:22 PM
The Lich Yard
Heck.
0 0
Ben ben.goff14
04/15/2017 3:42 PM
Encounter - Plains
hahhaahha
1 0
littleqman littleqman
04/15/2017 3:09 PM
Troupple Pond
ahhhhhh
1 0
Rowan Ben. rowan.bentley
04/15/2017 1:07 PM
Pridemoor Keep
two stages down without dieing many more to go.....
0 0
Jordan BigTracey
04/15/2017 1:01 PM
Pridemoor Keep
With a Shovel Knight code everything is easy.
0 0
Corrian kelloggs572
04/15/2017 12:58 PM
Iron Whale
1 0
PointyBits awyeahh
04/15/2017 12:54 PM
Plains
please stop the pain
2 0
Rowan Ben. rowan.bentley
04/15/2017 12:51 PM
Troupple Pond
Get the renewal ichor its very useful during boss fights and no death runs.
1 0
wiiston wiiston
04/15/2017 11:52 AM
Encounter - Reize
look closely he has a RELIC it makes fire go around him
1 0
gabriel gabrielashnikov
04/15/2017 11:10 AM
Finca de Liches
te hodio hespeq ter nai
0 0
littleqman littleqman
04/15/2017 10:27 AM
Stranded Ship (Plague)
ahhhhhh
0 0
Mikey TheChameleon284
04/15/2017 8:59 AM
Troupple Pond
2 0
undertale oswalda5
04/15/2017 8:54 AM
Clockwork Tower
2 0
ugly man Louierra
04/14/2017 8:57 PM
Troupple Pond
1 0
alexplayZ Alexander0325
04/14/2017 6:37 PM
Knuckler's Quarry
coolllllllllllllllll
1 0
littleqman littleqman
04/14/2017 6:15 PM
Village (Plague)
it is high noon
4 0
Zack Ithapher
04/14/2017 5:34 PM
Pridemoor Keep
4 0
Matthew Mecha-KnightXt
04/14/2017 4:40 PM
Fleet Flight
This is gonna take me a thousand tries, isn't it.
0 0
LinkStorXD nintenpikmin1302
04/14/2017 4:27 PM
Lost City
xXGodModeProGamerXx [TVSVUEIO]
2 0
lorno krupintupple
04/14/2017 3:46 PM
Plains (Plague)
wooob!
0 0
Q nallfamily
04/14/2017 3:46 PM
Flying Machine
THIS IS HARD on newgame+ # death to all green midgets
3 0
Zaren ZarenGame
04/14/2017 1:33 PM
Flying Machine
F*** propeller knights stage
0 0
Four eyes Blastbox22
04/14/2017 1:31 PM
Explodatorium (Plague)
What's this dimwit doing? He's supposed to be on your side!
5 2
Treventz teamrios2015
04/14/2017 12:01 PM
Plains
i hate this game
3 0
wesley SoulWesley
04/14/2017 11:34 AM
Pridemoor Keep
wow amazing boss
0 0
Andrew:) AWESOMEGUY84
04/14/2017 9:50 AM
Knuckler's Quarry
You have to dig instead
0 0
Andrew:) AWESOMEGUY84
04/14/2017 9:42 AM
Village
Have any of you found the trouple chalice?
4 0
Harrison Slam-A-coW_624
04/14/2017 8:04 AM
Armor Outpost
I have to say, all these armor sets are outstanding in their own way. I don't know which one to pick
3 0
Nathan sonickid18
04/14/2017 6:42 AM
Encounter - The Lich Yard
1 0
Johnny Johnny897
04/14/2017 3:32 AM
Pridemoor Keep (Plague)
You Can Hire The BAZ!!!!!!!!!!
3 0
jorgebros alemagno2000
04/13/2017 8:12 PM
Finca de Liches
está bueno!!!!!!
3 0
liltomatoe Liltomatoe
04/13/2017 6:08 PM
Lost City (Plague)
hello
1 0
epictaco majestictaco8022
04/13/2017 4:58 PM
Stranded Ship
TROUPLE KING
0 0
VGStar Kirblie
04/13/2017 3:47 PM
Flying Machine
Where is the music sheet for "High Above the Land?" I can only find "The Spin Controller."
0 0
Cameon superfast88
04/13/2017 2:26 PM
Clockwork Tower
at fsd hes eze then hes hard
1 0
josh fluffybabywa
04/13/2017 11:11 AM
Clockwork Tower (Plague)
I'll give you money for paper
0 0
$Devious$ SleepDemon
04/13/2017 10:35 AM
Armor Outpost (Plague)
Mona left me. SO DEPRESSED!!! I MISS HER!!!
4 0
Etinev ethanevan1972
04/13/2017 9:40 AM
Stranded Ship
4 0
Isabella WiiGoddess2016
04/13/2017 9:01 AM
Plains
1 0
Isaac IkeVonIsaac
04/13/2017 3:24 AM
Plains
1 0
Isaac IkeVonIsaac
04/13/2017 3:20 AM
Plains
0 0
Isaac IkeVonIsaac
04/13/2017 3:18 AM
Plains
0 0
Bobby Love badman461
04/12/2017 5:51 PM
Stranded Ship
2 0
Leonidus AllMyNamesTaken
04/12/2017 4:40 PM
Village (Plague)
Yeet
1 0
Theopold!? tyoier
04/12/2017 4:25 PM
Stranded Ship
finnaly
0 0
Theopold!? tyoier
04/12/2017 4:16 PM
Stranded Ship
2 Players for the win
5 0
nicholas megapizzaman
04/12/2017 3:32 PM
Tower of Fate: Entrance (Plague)
if you stick to the corner,that helps
0 0
frisk ☆ shyguyfan
04/12/2017 12:45 PM
Rematch: King Knight
DID IT OMGGGGGGGGGG
0 0
frisk ☆ shyguyfan
04/12/2017 12:42 PM
Rematch: King Knight
KING HAS ONE HALF A HEART LEFT BUT I DIED STUPID CONFETTI
0 0
SmallManYT SmallManCrosses
04/12/2017 12:38 PM
Pridemoor Keep
Book jump?... Really...
0 0
Ben GameBenAdvance
04/12/2017 9:01 AM
Plains
3 0
Brendan pastrymadman2015
04/12/2017 8:56 AM
Lost City
i cant defeat this guy
3 0
Brendan pastrymadman2015
04/12/2017 8:43 AM
Lost City
how do you defeat him
1 0
Spencer Heavensno
04/12/2017 3:53 AM
Lost City
Mole Schmole
0 0
angelo Angelo1024
04/11/2017 6:46 PM
The Lich Yard
i suck but its fun as a retro game
5 0
parkermon7 parkermon77
04/11/2017 6:08 PM
Plains
how do you play multiplayer
1 0
Alex Kimheng253
04/11/2017 5:59 PM
Tower of Fate: Ascent
ahhhhhhhhhh man
3 0
parkermon7 parkermon77
04/11/2017 5:56 PM
Plains
how do yiu play multiplayer
2 0
littleqman littleqman
04/11/2017 5:43 PM
Iron Whale (Plague)
this battle is rich
0 0
littleqman littleqman
04/11/2017 5:15 PM
The Lich Yard (Plague)
memes
0 0
frisk ☆ shyguyfan
04/11/2017 4:29 PM
Stranded Ship (Plague)
FIRST TIME BEAT LOLOL
0 0
Four eyes Blastbox22
04/11/2017 3:06 PM
Unarmed Ascent
The safest spot is at that far bookshelf!
0 0
Fnaf gaurd avidreader1085
04/11/2017 2:18 PM
Iron Whale
played this for 3 years! :3:3 :3:3:3:3:3:3:3:3 :-) :7 :-7 :l)
0 0
Max monty62221
04/11/2017 1:59 PM
Tower of Fate: Entrance
My worst Dream has come true....
5 0
carmelo Melo223
04/11/2017 1:29 PM
The Lich Yard
1 0
carmelo Melo223
04/11/2017 1:23 PM
The Lich Yard
0 0
Izerz05 Izerz05
04/11/2017 12:28 PM
Pridemoor Keep
Your about to taste justice. Shovel justice!
2 0
Izerz05 Izerz05
04/11/2017 12:08 PM
Plains
7 0
Izerz05 Izerz05
04/11/2017 12:07 PM
Plains
beat him first try
0 0
Izerz05 Izerz05
04/11/2017 11:58 AM
Plains
MLG!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
3 0
Santiago xaxfafmerXD
04/11/2017 11:40 AM
Armería
0 0
Chris chris_mingus
04/10/2017 6:09 PM
Armor Outpost
Wow, that was easy.
0 0
Johnny Johnny897
04/10/2017 5:44 PM
Explodatorium (Plague)
sooooo hardddddd
0 0
Nick Onikuma
04/10/2017 5:28 PM
The Lich Yard (Plague)
use lob bomb casing vs spectre!
3 0
frisk ☆ shyguyfan
04/10/2017 5:11 PM
Village (Plague)
i have played specter of torment, it actually wasn't as much fun as it looks, kinda dark and gloomy
3 0
Johnny Johnny897
04/10/2017 4:21 PM
Explodatorium (Plague)
Mabye beat pluge of showdows
1 0
Toonlink77 childers04
04/10/2017 3:14 PM
Explodatorium
Hee i remeber that at least i got the essence
1 0
Karkat jameil10
04/10/2017 2:42 PM
Flying Machine (Plague)
Been awhile.
1 0
César SuperSonicCesar
04/10/2017 2:24 PM
Lost City
i hate this level
1 0
nicholas megapizzaman
04/10/2017 12:08 PM
Tower of Fate: Entrance
0 0
chara vancerz
04/10/2017 10:22 AM
Lost City
holly shhuto
2 0
PK Paul.MN
04/10/2017 6:43 AM
Plains
iBET BLAK
4 0
casey cinders35
04/10/2017 4:35 AM
Pridemoor Keep
0 0
casey cinders35
04/10/2017 4:24 AM
Pridemoor Keep
0 0
Q nallfamily
04/09/2017 8:05 PM
Clockwork Tower
No need for relics
0 0
carcarsox soxfam
04/09/2017 6:27 PM
Tower of Fate: ???? (Plague)
why does dark pk get a bubble moped that shoots lasers and drives itself! come on!
3 0
мαττεгριε Pinkybud17
04/09/2017 6:11 PM
Flying Machine
The green propeller dudes are called `Meanies.` Fitting, right?
2 0
philburt GPEEZY
04/09/2017 5:06 PM
Explodatorium
we did it!!!
0 0
Chelle brightpixi
04/09/2017 5:03 PM
Plains
SHOVELS ARE COOL!
0 0
moral FryGuy25
04/09/2017 4:53 PM
Plains
how do you break blocks below you
2 1
Darren DQ_302
04/09/2017 3:16 PM
Pridemoor Keep
This is a very fun but challenging game
5 0
Chris chris_mingus
04/09/2017 2:22 PM
Stranded Ship
Am I the only one that doesn't know any of the cheat codes?
3 0
Luke Llakee
04/09/2017 12:47 PM
The Lich Yard
heeeellllp
2 1
Terrarian merkelbk
04/09/2017 12:36 PM
Iron Whale (Plague)
nyer
0 0
Chris chris_mingus
04/09/2017 12:35 PM
Flying Machine
Mail of Momentum helps with the coming fight.
0 0
ky GO gaming-O
04/09/2017 12:24 PM
Unarmed Ascent
this level is very hard to do wihout raging and in genrel
0 0
Ethan Rhygelaim
04/09/2017 12:17 PM
Tower of Fate: Ascent
does anyone know a code, cheat, secret to fight kratos in wiiu?
2 3
Ethan Rhygelaim
04/09/2017 12:15 PM
Tower of Fate: Ascent
does anyone know if there is a code, cheat, secret, to fight the battletoads in wiiu?
4 3
Chris chris_mingus
04/09/2017 12:14 PM
Clockwork Tower
Tinker goes down in one hit against the mobile gear.
1 0
Terrarian merkelbk
04/09/2017 11:30 AM
Tower of Fate: ???? (Plague)
i bejjhjcuu
0 0
Terrarian merkelbk
04/09/2017 11:23 AM
Tower of Fate: ???? (Plague)
moo
2 0
Terrarian merkelbk
04/09/2017 11:14 AM
Hall of Champions (Plague)
i love destruction
0 0
Terrarian merkelbk
04/09/2017 11:07 AM
Encounter - The Lich Yard (Plague)
yup
0 0
Terrarian merkelbk
04/09/2017 11:00 AM
Tower of Fate: ????
cole, you are correct
0 0
Link_BotW5 00969a
04/09/2017 10:59 AM
Flying Machine (Plague)
ai hate this stupid level!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
1 0
Terrarian merkelbk
04/09/2017 10:49 AM
Tower of Fate: Ascent
I FEEL LIKE A GOD TO BEAT THAT ROOM
2 0
Terrarian merkelbk
04/09/2017 10:48 AM
Tower of Fate: Ascent
it felt harder with supa speed
2 0
Jasperoid SergioSunshine
04/09/2017 10:19 AM
Clockwork Tower
7 0
Terrarian merkelbk
04/09/2017 10:16 AM
Encounter - Phantom Striker
i will reck him when i start fighting him because of god mode bra
1 0
Terrarian merkelbk
04/09/2017 10:04 AM
Frigid Flight
Pfft, flight? HA! I have cheats like the enchantress
1 0
frisk ☆ shyguyfan
04/09/2017 10:03 AM
The Lich Yard (Plague)
yaaaaas first try! take that spooky ghost!!!!!!!!
1 0
Terrarian merkelbk
04/09/2017 9:42 AM
Lost City
mole night is easy. He is seemingly invulnerable when he is on fire but hit the green flares back.
4 0
frisk ☆ shyguyfan
04/09/2017 9:17 AM
Rematch: Mole Knight
goddang it laaaaaavaaa does one heath bubble of damage
0 0
Terrarian merkelbk
04/09/2017 9:06 AM
Explodatorium
blarb
0 0
nick Minefreak68
04/09/2017 8:20 AM
Pridemoor Keep
0 0
wiiston wiiston
04/09/2017 8:19 AM
Tower of Fate: Entrance (Plague)
helo darness my old friend
1 0
jotaose jotaose
04/09/2017 6:05 AM
Villa
0 0
Mel B Melakhi
04/09/2017 4:00 AM
Village
4 1
Mel B Melakhi
04/09/2017 3:58 AM
Village
0 0
Mel B Melakhi
04/09/2017 3:40 AM
Village
3 1
narnae Legacy_Kids
04/08/2017 9:38 PM
Stranded Ship (Plague)
Do you like shovel knight?
1 0
Guts Jake787800
04/08/2017 6:05 PM
Plains
3 0
Spencer spencyrou
04/08/2017 4:22 PM
Clockwork Tower
Mobile gear one shot, Flare Razer multi hit, easy peasy! Thanks Custom Knight! (named '4 SHOVELRY')
0 0
Chris chris_mingus
04/08/2017 4:15 PM
Iron Whale
Use phase locket if you miss jump to not die.
1 0
Renzo LUDICROUS-LORD-R
04/08/2017 4:02 PM
Iron Whale
Best Game
1 0
Chris chris_mingus
04/08/2017 4:00 PM
Hall of Champions
Busting makes me feel good.
0 0
Chris chris_mingus
04/08/2017 3:52 PM
Hall of Champions
I ain't afraid of no ghost.
2 0
Chris chris_mingus
04/08/2017 3:33 PM
Encounter - Baz
He cries jewels.
0 0
Four eyes Blastbox22
04/08/2017 2:40 PM
Tower of Fate: ????
Self creating platforms? I wonder if they continue even if you go left...?
3 0
Johnny Johnny897
04/08/2017 11:50 AM
Plains
B Knight vs B Knight
1 0
Cornelius CornGames
04/08/2017 11:44 AM
Tower of Fate: Entrance
I just war horned him to death
1 0
Cornelius CornGames
04/08/2017 11:39 AM
Encounter - Baz
1 0
Johnny Johnny897
04/08/2017 11:33 AM
Armor Outpost
Sekle-team
1 0
Cornelius CornGames
04/08/2017 10:54 AM
Explodatorium
Im playing on god mode ha!
1 0
♪Annie♪ Mrs.Doobs
04/08/2017 10:29 AM
Village
I can't wait!!!
1 0
the boy jwkania
04/08/2017 9:17 AM
Plains
i defeated a boss
0 0
Frank ffury124
04/08/2017 8:43 AM
Troupple Pond
14 0
Spencer spencyrou
04/08/2017 6:18 AM
Armor Outpost
Heeere's my favorite character!
0 0
frisk ☆ shyguyfan
04/08/2017 5:45 AM
Pridemoor Keep (Plague)
DUDE after i visit the troupple king, i can hold the control stick down and dance!!!!
1 0
wah 44jsprod
04/08/2017 5:24 AM
Plains (Plague)
I know of a cheat code at the name select type x&butt it is awsome
1 0
Johnny Johnny897
04/08/2017 4:42 AM
Explodatorium
I dead
0 0
Johnny Johnny897
04/08/2017 4:07 AM
Pridemoor Keep
I have no power
0 0
Yalfmm yalfmm
04/07/2017 10:17 PM
Villa
hola
1 1
Chris chris_mingus
04/07/2017 7:33 PM
Forest of Phasing
The trick is to use the phase amulet.
1 0
Chris chris_mingus
04/07/2017 7:16 PM
The Lich Yard
Remember don't jump on people's graves in real life. That is rude.
4 0
Kayan kayanm
04/07/2017 7:05 PM
Iron Whale
0 0
maddox maddoxh2010
04/07/2017 6:50 PM
Tower of Fate: Entrance
1 0
jaceman stevomarshman
04/07/2017 6:38 PM
Troupple Pond
hardest guy ever!!!!!
4 0
Jacob Wewiiusongotsigh
04/07/2017 5:56 PM
Plains
so hard
3 0
Chris chris_mingus
04/07/2017 5:31 PM
Pridemoor Keep
Stand in the shovel knight silhouette
4 0
taghits taghits1357
04/07/2017 5:13 PM
Plains
got to dig
5 0
Ichigo ichigo103
04/07/2017 5:08 PM
Encounter - Reize (Plague)
0 0
Will KalirSavant
04/07/2017 4:03 PM
Rematch: Mr. Hat
Use the corners and your burst as your main weapons!
1 0
Will KalirSavant
04/07/2017 3:43 PM
Rematch: Black Knight
Wait for the meteors, then throw a ton!
0 0
André wcalegari
04/07/2017 2:59 PM
Plains
morri
1 0
James JDgaming21
04/07/2017 1:57 PM
Pridemoor Keep (Plague)
What'll it be fellas mustard or kethup
8 0
Dyl yellowsoccerdog
04/07/2017 1:56 PM
The Lich Yard
Awsome boss fight
2 0
James JDgaming21
04/07/2017 1:37 PM
The Lich Yard
1 0
James JDgaming21
04/07/2017 1:00 PM
Village
I luv this gaem. And imonly 2
1 0
Mooply sonicandmario073
04/07/2017 12:13 PM
Flying Machine
3 1
Jack Fatality14
04/07/2017 12:03 PM
Explodatorium
This level is probably the second worst out of this game...
0 0
Mooply sonicandmario073
04/07/2017 12:03 PM
Flying Machine
0 0
Angus Inferno133
04/07/2017 11:58 AM
Pridemoor Keep
How do you use your Relics???
1 0
DADDY BIGGY7
04/07/2017 11:00 AM
Iron Whale
1 0
William mari02608
04/07/2017 9:34 AM
Village
how do u play mutiplayer
1 4
André wcalegari
04/07/2017 7:18 AM
Plains
3 0
André wcalegari
04/07/2017 7:15 AM
Plains
2 0
lucas Lucas-Law
04/06/2017 7:53 PM
Armor Outpost
whos mister hat
0 0
Spencer spencyrou
04/06/2017 5:57 PM
Plains
So many Specter Knight icons and with good reason, but there's me with Mr. Hat.
1 1
nug tijsean
04/06/2017 5:46 PM
Tower of Fate: Entrance
1 0
Four eyes Blastbox22
04/06/2017 5:04 PM
Tower of Fate: Entrance
Dark blue platforms will fall after you stand on them! Move quickly!
2 0
Four eyes Blastbox22
04/06/2017 5:01 PM
Clockwork Tower
An autoscroll climb awaits in the next room. Beware.
1 0
Four eyes Blastbox22
04/06/2017 4:49 PM
Tower of Fate: Entrance
Now that you stand at the Tower, ALL of the Enchantress's minions will appear. Steel thy shovel!
3 0
Four eyes Blastbox22
04/06/2017 4:46 PM
Tower of Fate: Entrance
It's a bit hard to see with the rain, but there's a fishing spot here. You know what to do.
1 0
Asriel eonkohr9
04/06/2017 4:01 PM
Tower of Fate: Entrance
long time i haven't played this game
1 0
andrew amd638
04/06/2017 9:50 AM
Tower of Fate: ????
at enchantress ready for the end
4 0
Porter porter100
04/06/2017 8:53 AM
Plains
i activated butt mode
7 0
daboy DaBoy2
04/06/2017 7:46 AM
The Lich Yard
1 0
daboy DaBoy2
04/06/2017 7:36 AM
The Lich Yard
1 0
daboy DaBoy2
04/06/2017 7:34 AM
The Lich Yard
just started playing again
1 0
grammy grampy1959
04/06/2017 6:39 AM
Explodatorium
1 0
littleqman littleqman
04/06/2017 5:49 AM
Village (Plague)
memes
6 0
Ashe ParanormalSkitty
04/05/2017 9:13 PM
Pridemoor Keep (Plague)
2 0
Ashe ParanormalSkitty
04/05/2017 9:11 PM
Pridemoor Keep (Plague)
4 0
Ashe ParanormalSkitty
04/05/2017 9:07 PM
Pridemoor Keep (Plague)
3 0
N5★wolf likeaboss425
04/05/2017 6:58 PM
The Lich Yard
Gonna die soon
3 0
Jordan OhYesImaWolf1997
04/05/2017 6:27 PM
Lost City
Ever hear of dying and winning at the same time? ._.
0 0
Jordan OhYesImaWolf1997
04/05/2017 6:04 PM
Explodatorium
I really don't like his potion move, but overall a good fight! :D
0 0
jig abby71833
04/05/2017 5:51 PM
Plains
4 0
L–man Kingofawesome75
04/05/2017 5:01 PM
Troupple Pond
Long may his stem grow!
3 0
Four eyes Blastbox22
04/05/2017 4:05 PM
Flying Machine
He lunges quickly while he gets fire support from his ship! Avoid being blown into pits!
1 0
Four eyes Blastbox22
04/05/2017 3:49 PM
Flying Machine
The sheer weight of the machine will sweep you off your feet when it lands! Time your jumps!
3 0
dr aj asmer1130
04/05/2017 3:29 PM
Stranded Ship
phase locket
2 0
Four eyes Blastbox22
04/05/2017 3:08 PM
The Lich Yard
Don't open that plate! The flavor in that lunch is far too...explosive.
3 0
dr aj asmer1130
04/05/2017 2:53 PM
Stranded Ship
I dare anyone, ANYONE to play this game but every checkpoint you reach, YOU DISTROY IT!
1 0
leah pinkkitten42
04/05/2017 2:36 PM
Plains
this boss is SO HARD!
3 0
dr aj asmer1130
04/05/2017 2:01 PM
Clockwork Tower
INFINADAGGER!
0 0
David dgaliata
04/05/2017 10:04 AM
Tower of Fate: ????
4 0
Roger rogerf1025
04/05/2017 6:08 AM
Explodatorium
im a pro bro! easy!
1 0
Joey JoeyGame
04/04/2017 6:26 PM
Stranded Ship
I want one of those wolves.
2 0
Thor WiiUandIParty
04/04/2017 5:53 PM
Tower of Fate: Ascent
New Game+.....Here we go...
3 0
Matthew Mecha-KnightXt
04/04/2017 3:50 PM
Tower of Fate: Entrance (Plague)
HE HAD HALF A HEALTH-BUBBLE LEFT! HALF!
3 0
Matthew Mecha-KnightXt
04/04/2017 3:33 PM
Tower of Fate: Entrance (Plague)
Seriously, can someone help me...please....
0 0
Matthew Mecha-KnightXt
04/04/2017 3:31 PM
Tower of Fate: Entrance (Plague)
This stupid boss fight will be the death of me. The New Game + version of Black Knight can bite me.
2 0
Scout CntrlCCntrlV
04/04/2017 1:06 PM
Lost City
I jumped off a cliff the other day.
4 0
Anderson vingador2
04/04/2017 12:43 PM
Pridemoor Keep
jogo bom demais
0 0
Red Army Wag1981
04/04/2017 11:58 AM
La Ciudad Perdida
que juego mas bueno estilo vieja escuela
0 0
Jonny5 Jonny105
04/03/2017 9:05 PM
The Lich Yard
Lol ''For shovelery'' still as fun as when i first got it.
1 0
Jonah mugNflee
04/03/2017 8:34 PM
Campiña
Wuju
1 0
Four eyes Blastbox22
04/03/2017 7:54 PM
Flying Machine
They electrify in sequence! When the third lights up, the first will power down! That's your moment!
1 0
Four eyes Blastbox22
04/03/2017 7:51 PM
Flying Machine
There appears to be a room below, but those blasted fans...perhaps a relic could block them somehow?
2 1
PAC-MAN soniccd020
04/03/2017 3:39 PM
Forest of Phasing
THIS GAME IS AWESOME!
7 0
jesse JediLeroy
04/03/2017 3:15 PM
Plains (Plague)
fthrgyjh
1 0
Evan Emaniac25
04/03/2017 2:49 PM
Plains
I love this game!!
1 0
frisk ☆ shyguyfan
04/03/2017 2:05 PM
Clockwork Tower (Plague)
the berserkers brew comes in handy with this level (you get berserkers brew from polar knight stage)
0 0
frisk ☆ shyguyfan
04/03/2017 2:02 PM
Clockwork Tower (Plague)
i had to barge in here from the first checkpoint over literally 29 dang times
3 0
Porter porter100
04/03/2017 1:21 PM
The Lich Yard
Well... Theres a secret....
7 0
Porter porter100
04/03/2017 1:14 PM
The Lich Yard
I just got this game!
0 0
Eclans MasterChief2778
04/03/2017 12:42 PM
Villa
Me gusta este juego :)
2 0
abel abelcruz11
04/03/2017 10:33 AM
Clockwork Tower
i got rekt im done with dis game
4 1
carcarsox soxfam
04/03/2017 8:52 AM
Tower of Fate: Entrance (Plague)
what the heck happened to black knight? laxt time i saw him, i beat him first try!
5 0
property neardental
04/03/2017 8:44 AM
Máquina Voladora
1 0
carcarsox soxfam
04/03/2017 8:03 AM
Clockwork Tower (Plague)
grayson... that is the most indie picture my eyes have every laid eyes on... and its awesome!
2 0
Peter TychicusDH
04/03/2017 7:48 AM
Village
2 0
IamTabu toadman19832
04/02/2017 6:16 PM
Plains
sup my dudes
4 0
PSS∞LιηεяJ liner1998
04/02/2017 5:47 PM
Campiña
3 0
Marco MarcoJackson
04/02/2017 4:12 PM
Iron Whale
This game is hard but fun
2 0
decky dexauden
04/02/2017 3:33 PM
The Lich Yard
I love this game.
2 0
decky dexauden
04/02/2017 3:25 PM
Troupple Pond
0 0
Tony tbrocks111
04/02/2017 3:14 PM
Rematch: Reize
0 0
0wen rOwen23
04/02/2017 3:02 PM
Armor Outpost (Plague)
how do you change cloaks :-(
1 0
Wayne leilock
04/02/2017 1:31 PM
Plains
2 0
C.T.C.C.³ The_C-Mega_Gamer
04/02/2017 12:46 PM
Troupple Pond
Trout Apple. He's a cannibal! (Fish in the pond)
2 0
frisk ☆ shyguyfan
04/02/2017 11:50 AM
The Lich Yard (Plague)
I don't like levels I can't see!
1 0
Bear scottbrook
04/02/2017 10:36 AM
Pridemoor Keep
this can get very hard
0 0
Coll lucariomaster8
04/02/2017 9:48 AM
Explodatorium
2 0
Coll lucariomaster8
04/02/2017 9:43 AM
Explodatorium
2 0
Daniel Thearbiter20x6
04/02/2017 8:51 AM
Tower of Fate: Ascent (Plague)
Plague Knight no checkpoint run ><
0 0
frisk ☆ shyguyfan
04/02/2017 6:29 AM
Plains (Plague)
HOW
1 0
frisk ☆ shyguyfan
04/02/2017 6:12 AM
Plains (Plague)
used code to get this mode lol
3 0
frisk ☆ shyguyfan
04/02/2017 6:01 AM
Birder Herder
i used secret code to unlock this mode lol
0 0
Quikster Quikster11
04/02/2017 4:33 AM
Flying Machine
gfxv
0 0
Four eyes Blastbox22
04/02/2017 12:18 AM
Clockwork Tower
The real battle begins! His machine's mostly for show, just climb the drill or his bombs and attack!
3 0
Four eyes Blastbox22
04/02/2017 12:16 AM
Clockwork Tower
He's...definitely not what you're expecting, but don't underestimate him; wrenches hurt!
2 0
Four eyes Blastbox22
04/01/2017 11:17 PM
Clockwork Tower
These spinning platforms may be stood on even by jumping from below, but gradually spin you off.
2 0
lex legolex0511
04/01/2017 7:24 PM
Forest of Fishing (Plague)
dank memes
4 0
Sam Mr.ferret14
04/01/2017 5:13 PM
Tower of Fate: ???? (Plague)
This is the best part in the game
1 0
Riley PrincessRGG
04/01/2017 1:10 PM
Plains
2 0
Q nallfamily
04/01/2017 12:50 PM
Troupple Pond
all hail king t ! :>
1 0
Buzz CheeseMo3rd
04/01/2017 12:10 PM
Tower of Fate: Ascent (Plague)
Well, at least there's no rainbow riders to use. Also, go OVER the tall wall half way through.
0 0
Logan nitschke5150
04/01/2017 9:39 AM
Pridemoor Keep
3 0
Buzz CheeseMo3rd
04/01/2017 9:38 AM
Shivering Sprint (Plague)
Not gonna lie, once you know how to properly use the dash potion, this is a really fun mini stage!
0 0
andy 8bitmau5
04/01/2017 8:39 AM
Flying Machine
1 0
Cormac NovaWeilder98
04/01/2017 7:14 AM
Clockwork Tower
i hate tiinker knight so much
1 0
Mel B Melakhi
04/01/2017 12:24 AM
Village
1 0
Buzz CheeseMo3rd
03/31/2017 7:38 PM
Clockwork Tower (Plague)
Those missles man...
3 0
Jude theCornyJoke
03/31/2017 6:35 PM
Stranded Ship
The Ice Knight is probably one of the harder bosses! >_<
1 1
memo 2tonone
03/31/2017 5:35 PM
Pridemoor Keep
0 0
carter waddledee63
03/31/2017 3:59 PM
Village
Hey, does anybody know how to beat Polar Knight?
2 0
carter waddledee63
03/31/2017 3:13 PM
Village
I bought all of the meal tickets ALREADY?!? How is this even POSSIBLE?!?
3 0
kaimana kaimanaf
03/31/2017 3:07 PM
Pridemoor Keep (Plague)
hi guys im cool noticeme please
4 0
Andrew nhjhghhhbbyhhhju
03/31/2017 2:57 PM
The Lich Yard
Yes I finally beat him!
0 0
Andrew nhjhghhhbbyhhhju
03/31/2017 2:55 PM
The Lich Yard
Im so close every time
1 0
carter waddledee63
03/31/2017 2:51 PM
Troupple Pond
All hail the Troupple King, as he is a better dancer than I! Here, here!
1 0
Andrew nhjhghhhbbyhhhju
03/31/2017 2:08 PM
Plains
You can dig at the fire and it gives you money.
8 0
Andrew nhjhghhhbbyhhhju
03/31/2017 2:04 PM
Plains
Black knight will be easy.
4 0
savage man Orrinsj
03/31/2017 1:17 PM
Plains
boo ya i did it! in your face!
0 0
Buzz CheeseMo3rd
03/30/2017 8:03 PM
Bottomless Quarry (Plague)
Two major things: 1. USE FLOAT BURST 2. TIMING
1 0
TBGD TheBGDragon
03/30/2017 7:19 PM
shortcut? (Plague)
NOOOO MONAAAA! ;(
2 0
carter waddledee63
03/30/2017 6:39 PM
Village
Eye B awl shiny like in muh Dynamo Mail. (lol)
0 0
carter waddledee63
03/30/2017 6:37 PM
Village
Mole Knight down! At least he's easier than Phantom Knight...
2 0
Jeff Chunkycorgin
03/30/2017 6:30 PM
Pridemoor Keep
If there is something that this game taught me, it is to go backwards if possible.
5 0
mememememe ilovcandey1100
03/30/2017 5:08 PM
Lost City
7 0
danny arkstone
03/30/2017 4:49 PM
Iron Whale
it took me a year but i fially beat him
0 0
Goat jamswiiu
03/30/2017 4:27 PM
Plains (Plague)
uhh im so bad uhhhhhhbhhhhh
2 0
savage man Orrinsj
03/30/2017 4:15 PM
Plains
@ gmail.com u shovel kids
3 0
Nathan sonickid18
03/30/2017 4:13 PM
Stranded Ship
I beat poler knight finally !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
0 0
savage man Orrinsj
03/30/2017 4:13 PM
Plains
0 0
Nathan sonickid18
03/30/2017 3:44 PM
Stranded Ship
3 0
TBGD TheBGDragon
03/30/2017 3:33 PM
shortcut? (Plague)
I LOVE this game :)
1 0
Starret Keyotea
03/30/2017 1:56 PM
Troupple Pond
Hail the tropple king.
4 0
Julian fanofstampy12
03/29/2017 7:22 PM
Pridemoor Keep
ded
0 0
lol Charlie837
03/29/2017 5:57 PM
Flying Machine
im king frick yeah
0 0
Daddy Todimushin
03/29/2017 5:35 PM
Pridemoor Keep
1 0
savage man Orrinsj
03/29/2017 3:42 PM
Plains
1 0
Milo ject16
03/29/2017 1:52 PM
Pridemoor Keep
i got the ghost gloves!!
0 0
Splatooner mvalviar
03/29/2017 2:37 AM
Village
This is the look of my girlfriend <--------------
5 0
Splatooner mvalviar
03/29/2017 2:33 AM
Village
5 0
Marco ndolphin64
03/28/2017 7:17 PM
Shivering Sprint (Plague)
THAT WAS NUTS :)
0 0
Milo ject16
03/28/2017 5:35 PM
Plains (Plague)
i got plague of shadows!!!
0 0
Johnnyboy jfalcon613
03/28/2017 4:41 PM
Explodatorium
1 0
Johnnyboy jfalcon613
03/28/2017 4:38 PM
Explodatorium
3 0
lex legolex0511
03/28/2017 3:20 PM
Encounter - Baz
he just want to be the great baz knight
0 0
lex legolex0511
03/28/2017 3:15 PM
Lost City
easy-peasy
0 0
Toddy Toddamis
03/27/2017 8:05 PM
Plains
allah akbar
2 0
Four eyes Blastbox22
03/27/2017 7:27 PM
Lost City
The Dust Knuckles will be your best friend when he sends blocks at you!
6 0
Four eyes Blastbox22
03/27/2017 7:14 PM
Lost City
Bless these lava-dwelling fish for being so convenient footstools!
7 0
Four eyes Blastbox22
03/27/2017 6:27 PM
Hall of Champions
All these people fretting about celebrities, and i'm just trying not to get attacked by ghosts!
2 0
greysen greysendrake
03/27/2017 6:25 PM
Pridemoor Keep
1 0
greysen greysendrake
03/27/2017 6:22 PM
Pridemoor Keep
0 0
Four eyes Blastbox22
03/27/2017 6:20 PM
Hall of Champions
Wondering why you fell? Notice the colors of the statues' swords. The puple ones denote gaps!
1 0
Four eyes Blastbox22
03/27/2017 6:18 PM
Hall of Champions
The orbs here appear to be the only thing that can permanently stop these spirits!
2 0
greysen greysendrake
03/27/2017 6:12 PM
Village
5 0
RIBBIT ribbit3603
03/27/2017 6:07 PM
Forest of Fishing (Plague)
When you search the whole level for an hour, but you cannot find the last cipher coin
0 0
Aidan Kleiyoshi
03/27/2017 6:02 PM
Tandem Travels
WHY IS THIS SO HARD!!!
2 0
DyLaN Sprmw11
03/27/2017 5:56 PM
Tower of Fate: Ascent
this is the only post here
0 1
DyLaN Sprmw11
03/27/2017 5:40 PM
Village
if you talk to hoop kid the hoop still moves.
0 0
squidtiger GamingGator425
03/27/2017 7:44 AM
Hall of Champions (Plague)
how many green coins are in the game i have 58 lol
0 0
Logan Wii3Boyz
03/27/2017 6:42 AM
Tower of Fate: Ascent
rage quit!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
3 0
Logan Wii3Boyz
03/27/2017 6:34 AM
Tower of Fate: Ascent
polar knight is the worst i cannot deal with the spikes
1 0
Logan Wii3Boyz
03/27/2017 6:29 AM
Tower of Fate: Ascent
why do I have to fight every boss in the game again it was hard enough!
2 0
Joe Ragdoll72
03/27/2017 6:07 AM
Plains (Plague)
ahhhhhhhhh plague knight mode is so hard i cant beat the first level
3 0
Splatooner mvalviar
03/26/2017 9:53 PM
Armor Outpost
YES FINNALY I BEAT THE GAME YYYYYYYEEEEEEESSSSSS!!!!!(The ending is so good)
1 0
Splatooner mvalviar
03/26/2017 9:43 PM
Armor Outpost
Guys I have a girlfriend now on SHOVEL KNIGHT! :D
4 0
Splatooner mvalviar
03/26/2017 9:15 PM
Plains
Hey Guys Can You Plz. Talk
1 0
Benji benthebass81
03/26/2017 8:16 PM
Explodatorium
3 0
greysen greysendrake
03/26/2017 5:11 PM
Village
3 0
wiiston wiiston
03/26/2017 3:04 PM
Tower of Fate: Ascent
i rage quit this level 13 times so i'd turn back (i was on game+)
2 1
wiiston wiiston
03/26/2017 2:54 PM
Tower of Fate: Ascent
RAGE QUIT!!!!!!!!!!!!!!
2 0
Mommii TheHitt5
03/26/2017 2:33 PM
Tower of Fate: Ascent
god mode is amazing, i agree
3 0
wiiston wiiston
03/26/2017 2:29 PM
Tower of Fate: Ascent
NOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO
1 0
wiiston wiiston
03/26/2017 2:24 PM
Tower of Fate: Ascent
NEW GAME+ ONE KNIGHT LEFT AND DIE AHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
3 0
greysen greysendrake
03/26/2017 2:23 PM
Pridemoor Keep
0 0
maddie zach-a-boog
03/26/2017 1:57 PM
Troupple Pond
1 0
wiiston wiiston
03/26/2017 1:33 PM
Tower of Fate: Entrance
first comment
1 0
wiiston wiiston
03/26/2017 1:32 PM
Tower of Fate: Entrance
the key is the rain
3 0
wiiston wiiston
03/26/2017 1:26 PM
Tower of Fate: Entrance
first comment
3 0
joako joakobkn
03/26/2017 1:22 PM
Pridemoor Keep
1 0
wiiston wiiston
03/26/2017 1:19 PM
Tower of Fate: Entrance
first comment
1 0
wiiston wiiston
03/26/2017 12:57 PM
Clockwork Tower
no hits on me XD
1 0
Mommii TheHitt5
03/26/2017 11:37 AM
Village
sup people
1 0
abel abelcruz11
03/26/2017 11:33 AM
The Lich Yard
0 0
Lalann Caarolanne
03/26/2017 10:42 AM
Plaines
whoooa
0 0
wiiston wiiston
03/26/2017 9:42 AM
Clockwork Tower
i NEVER fell of his robutt
0 0
wiiston wiiston
03/26/2017 9:36 AM
Clockwork Tower
first try :]
1 0
Drifter Marcelloblahblah
03/26/2017 8:33 AM
Plains
Awesome Game I Love it!
8 0
inkling♀ IceFive5
03/26/2017 8:31 AM
Iron Whale
HELP
1 0
Ethan Kirby64955
03/26/2017 7:56 AM
The Lich Yard
3 0
Spencer spencyrou
03/26/2017 7:29 AM
Hall of Champions (Plague)
Is that Game Grumps?!
1 0
nikki Rosco415
03/25/2017 7:27 PM
Village
Get money, get beat up, REPEAT CYCLE!
5 0
Sadie SansaSnark
03/25/2017 6:47 PM
Tower of Fate: Entrance
So much darkness...
0 0
wiiston wiiston
03/25/2017 6:10 PM
Dragon Chase Race
those are dragons? i thought they were flying frogs!!!
0 0
Ronnie MinecrafterRon
03/25/2017 5:49 PM
Explodatorium
0 0
Aldrich Aldrich.exe
03/25/2017 5:00 PM
La Ciudad Perdida
1 0
Cam traydfull
03/25/2017 4:56 PM
Hall of Champions
in plauge of shadows it is reaveled plauge knight caused the big creep to show up
1 0
Gerardo gerardogerardo
03/25/2017 4:26 PM
The Lich Yard
1 3
Xavier GamesAreMyLife
03/25/2017 3:36 PM
Plains (Plague)
I "BIRD" that this game was good it wasnt a lie this game really is a "The bomb"
2 0
Markell MVWatkins17
03/25/2017 3:34 PM
Clockwork Tower
tin cannnn is defeated
1 0
Xavier GamesAreMyLife
03/25/2017 3:33 PM
Plains (Plague)
This level is just "EXPLODING" with exitment HEE HEE
0 0
Xavier GamesAreMyLife
03/25/2017 3:30 PM
Plains (Plague)
This will be a "BLAST" HEE HEE
2 0
Xavier GamesAreMyLife
03/25/2017 3:24 PM
Village (Plague)
Teenage mutent ninja birds
3 0
Xavier GamesAreMyLife
03/25/2017 3:15 PM
Troupple Pond (Plague)
4 0
janoNEO alejandrobacNEO
03/25/2017 3:09 PM
Villa
compren vales de comida
3 0
AgentGamer Tsopem21
03/25/2017 1:50 PM
The Lich Yard
1 0
Cameron itisI0
03/25/2017 1:07 PM
Pridemoor Keep
the rage is real
4 0
Garrett RedLink333
03/25/2017 12:13 PM
Plains
4 0
logan logandagnino
03/25/2017 11:24 AM
The Lich Yard
1 0
noah nononoah07
03/25/2017 10:47 AM
Plains
amibo shovel knight is so o.p
0 0
wiiston wiiston
03/25/2017 8:21 AM
Tower of Fate: ???? (Plague)
I HAD HER DOWN TO 1 HALF LIFE
2 0
Cam traydfull
03/25/2017 7:43 AM
Village
got all of the music sheets 5of them are in the last level
2 0
Dad shanek24
03/25/2017 5:13 AM
Forest of Phasing
6 0
wiiston wiiston
03/24/2017 10:16 PM
Tower of Fate: ???? (Plague)
go left!!!!!
1 0
wiiston wiiston
03/24/2017 9:42 PM
Tower of Fate: Entrance (Plague)
FOR MOANA
1 0
wiiston wiiston
03/24/2017 9:36 PM
Tower of Fate: Entrance (Plague)
FIRST TRY \(O-O)/
1 0
wiiston wiiston
03/24/2017 9:10 PM
Flying Machine (Plague)
0 0
Mikey PandaGuy252
03/24/2017 8:45 PM
Iron Whale
I really DIG this game!
3 0
wiiston wiiston
03/24/2017 8:26 PM
Clockwork Tower (Plague)
lob case cluster pouter
2 0
carcarsox soxfam
03/24/2017 8:25 PM
Explodatorium (Plague)
how do u unlock specter of torment (please answer)
2 0
carcarsox soxfam
03/24/2017 8:15 PM
Village (Plague)
how do you get specter of torment?
10 3
carcarsox soxfam
03/24/2017 8:07 PM
The Lich Yard (Plague)
specter knight is soooo hard with plauge knight!at least i have leech liquid.
2 0
frisk ☆ shyguyfan
03/24/2017 5:21 PM
Frigid Flight
u need the propeller dagger
1 0
abel abelcruz11
03/24/2017 4:57 PM
Pridemoor Keep
0 0
Sebhys Sebhys
03/24/2017 4:53 PM
Armería
para que sirve la armadura dorada
1 2
frisk ☆ shyguyfan
03/24/2017 4:39 PM
Troupple Pond
dance!
1 0
abel abelcruz11
03/24/2017 4:39 PM
Pridemoor Keep
omg dis game iz goods
2 0
andy 8bitmau5
03/24/2017 4:35 PM
Explodatorium
halpme kill this evil plague knight!
2 0
mudkiper yoshikirby99
03/24/2017 4:15 PM
Plains
Wow this is fun
1 0
Four eyes Blastbox22
03/24/2017 3:47 PM
Plains
When he jumps back to fire a shot, you can hit it back! Try to cross under him when he dives at you!
7 0
B LANER_FAMILY
03/24/2017 3:28 PM
Iron Whale
xedr'
2 0
Four eyes Blastbox22
03/24/2017 3:21 PM
Lost City
This mighty behemoth can cleave three off your health in one stroke! Don't get careless!
2 0
Four eyes Blastbox22
03/24/2017 3:14 PM
Lost City
Don't be so quick to detonates those blocks! Something could be hidden above!
4 0
Jake WookieGamer36
03/24/2017 3:11 PM
Plains
william sux
4 1
Four eyes Blastbox22
03/24/2017 3:10 PM
Lost City
Egad! Seems like some bugs ARE cozy with adventurers! You think he's related to the beetle foes?
2 1
Luke Lukeman2010
03/24/2017 2:39 PM
Troupple Pond
im a bad butt butt player
0 0
frisk ☆ shyguyfan
03/24/2017 2:06 PM
Stranded Ship
my god polar knight is tough
1 0
frisk ☆ shyguyfan
03/24/2017 12:58 PM
Clockwork Tower
his part two: jump on his head and pogo stick!
0 0
frisk ☆ shyguyfan
03/24/2017 12:54 PM
Clockwork Tower
god da#n f#cking vertical autoscroll
0 0
frisk ☆ shyguyfan
03/24/2017 12:40 PM
Stranded Ship
stupid god da#n polar knight is taking all my loot #rage quit
2 0
Toonlink77 childers04
03/24/2017 9:53 AM
Flying Machine (Plague)
Wow hee hee this is difficult BOOM
1 0
k.k cloey9311
03/24/2017 8:06 AM
Explodatorium
im a try hard but still bad
0 0
Lion kopa92
03/24/2017 7:56 AM
Torre del Hado: Ascensión
gd
0 0
Billy billbrad
03/24/2017 5:47 AM
Tower of Fate: Ascent
jeez polerknight is tough
3 0
Spencer spencyrou
03/24/2017 4:07 AM
Encounter - The Lich Yard
This game is great! I got it yesterday. Is Specter of Torment on Wii U?
0 2
mario creeptothecraft
03/23/2017 10:06 PM
Plains
4 0
timmy therealtimjam
03/23/2017 9:47 PM
Pridemoor Keep
2 0
pass koopa428
03/23/2017 8:41 PM
Pridemoor Keep
This game is so fun and hard atthe same time:-) (i love chickens)
1 0
David DavEd3464
03/23/2017 7:07 PM
Fortaleza del Orgullo (Plague)
Izi
0 0
wiiston wiiston
03/23/2017 6:51 PM
Explodatorium (Plague)
theres a glich bom burst on this raised plat form the top of the next room
3 0
wiiston wiiston
03/23/2017 6:31 PM
Encounter - Reize (Plague)
NO HIT REZE
0 0
wiiston wiiston
03/23/2017 6:22 PM
Encounter - Reize (Plague)
he haz a relic!!!!!!
0 0
Louis Jr$$ eciacura4
03/23/2017 6:06 PM
Village
"My potions were created when I burnt ethanol, drugs, and SCIENCE 'just right'."
5 0
Louis Jr$$ eciacura4
03/23/2017 6:04 PM
Village
How did the Bard's music get scattered to ALL of the levels? True antagonist of Shovel Knight? WIND.
6 0
Brian Bone2725
03/23/2017 4:47 PM
Plains
I love this game when can we play as king or specter knight
5 0
frisk ☆ shyguyfan
03/23/2017 3:10 PM
Iron Whale
so.. let me get this straight, i beat plague knight, but i cant beat THIS?!?!
2 0
Russell superzelda10
03/23/2017 2:48 PM
The Lich Yard
i dont no what to do
1 2
frisk ☆ shyguyfan
03/23/2017 2:19 PM
Explodatorium
my god, when you die, look on the gamepad youll see dead curled-up shovel knight omg!!!!!!
1 0
frisk ☆ shyguyfan
03/23/2017 2:11 PM
Explodatorium
0 0
gabriel ArmCannon111
03/23/2017 12:21 PM
The Lich Yard
THIS STAGE IS SO HARD
3 0
Indy ElectronCloud
03/22/2017 8:01 PM
Plains
4 0
frisk ☆ shyguyfan
03/22/2017 4:15 PM
The Lich Yard
omg this lvl sacks
1 0
janoNEO alejandrobacNEO
03/22/2017 4:04 PM
Villa
esta buno el mini juego y el juego
0 0
janoNEO alejandrobacNEO
03/22/2017 3:57 PM
Villa
enchilada :v
1 0
Galax 7777 Galax7777
03/22/2017 2:38 PM
La Ciudad Perdida
Hola
0 0
Eddie UuDdLrBa1
03/22/2017 2:32 PM
Pridemoor Keep
0 6
Eddie UuDdLrBa1
03/22/2017 2:29 PM
Pridemoor Keep
never mind
1 0
Eddie UuDdLrBa1
03/22/2017 2:29 PM
Pridemoor Keep
how do you get the black knight avatar
1 0
joey KarateKid238
03/22/2017 1:49 PM
Stranded Ship
That was the most tedious thing I`ve ever done!!
0 0
Max ca3sa3ma3ab
03/22/2017 12:57 PM
Rematch: Mole Knight
yee i did it
0 0
Max ca3sa3ma3ab
03/22/2017 12:45 PM
Rematch: Mole Knight
0 0
Max ca3sa3ma3ab
03/22/2017 12:39 PM
Rematch: Mole Knight
wow hard to kill
1 0
Corrian kelloggs572
03/22/2017 10:33 AM
Lost City
3 0
Corrian kelloggs572
03/22/2017 10:28 AM
Lost City
2 0
Squeaky Pandas4lyfe2
03/22/2017 4:36 AM
Pridemoor Keep
Died by a rat... GoodKNIGHT Sweet prince
0 0
Lup☆ doctorbleak
03/22/2017 12:09 AM
Village (Plague)
one piece of gear to go! aside from the coins anyways
2 5
Marco ndolphin64
03/21/2017 11:41 PM
Forest of Fishing (Plague)
Where's the last coin on the forest of fishing?
4 0
RageZorua RagingZorua
03/21/2017 9:01 PM
Clockwork Tower
I used a cheatcode but the part where the screen rolls up broke the game i'm stuck at the bottom ;-;
0 0
carcarsox soxfam
03/21/2017 8:58 PM
Plains (Plague)
i just discovered plague of shadows!
0 0
lementor sanlima7
03/21/2017 7:56 PM
Torre del Hado: Ascensión
fuc! this game for 2 years old
0 0
conor liamct
03/21/2017 7:28 PM
Armor Outpost
so sad just started playing
3 0
Chaplain Arthelos
03/21/2017 6:47 PM
Plains (Plague)
Just started playing plague knight. Its not going very well.
0 0
Squeaky Pandas4lyfe2
03/21/2017 4:26 PM
Plains
FINALLY BEAT BLACK KNIGHT!
0 0
LEOHRMOSA leonorgamer
03/21/2017 1:20 PM
Finca de Liches
facil
1 0
Max ca3sa3ma3ab
03/21/2017 12:46 PM
Tower of Fate: Entrance
gawd darng it
2 0
Buzz CheeseMo3rd
03/21/2017 12:00 PM
Tower of Fate: Ascent
Hope you didn't plan on saving your gold up to this point, cause you're gonna be losing A LOT of it.
1 1
grammy grampy1959
03/21/2017 11:51 AM
Plains
5 0
Tavares Tavares2105
03/21/2017 8:04 AM
Village (Plague)
helooooooooo!
3 0
Tavares Tavares2105
03/21/2017 8:02 AM
Village (Plague)
sup!
1 0
Dav13gamer Dav13gamer
03/20/2017 7:39 PM
Torre del Hado: Ascensión
ykgttuhyjhnmkoyt (RAGE >:C)
2 1
яőġüëραňðά HSsword49
03/20/2017 7:36 PM
Plains
#gotemcheatcodesandwerereadytogo
5 0
jas 2 452170
03/20/2017 7:34 PM
Fortaleza del Orgullo
king knight no me toco en ningun momento
1 0
jas 2 452170
03/20/2017 7:16 PM
Finca de Liches
0 0
jas 2 452170
03/20/2017 7:00 PM
Campiña
derrote a el primer jefe
0 0
andy 8bitmau5
03/20/2017 3:40 PM
Plains
on my way!
1 0
Reyes mengual.family
03/20/2017 2:04 PM
Plains
1 0
SonicDork SonicDork483
03/20/2017 12:42 PM
Pridemoor Keep
this game is sexy
2 0
Spencer Heavensno
03/19/2017 10:44 PM
Pridemoor Keep
9 0
Lup☆ doctorbleak
03/19/2017 9:56 PM
Village (Plague)
outrageous bummer that we gotta wait until april for specter of torment everywhere but on the switch
2 0
Favio Davi nees08
03/19/2017 7:47 PM
Fortaleza del Orgullo
16 Bits bien echos
2 0
DrObvious DrObviously
03/19/2017 6:53 PM
The Lich Yard
my name dead
0 0
me? sethio11
03/19/2017 4:56 PM
Village (Plague)
this new mode is downright amazing!
4 0
mikey michalis2017
03/19/2017 2:13 PM
Plains
hello fellow
6 0
Quincy blackbird1030
03/19/2017 1:57 PM
Encounter - Reize
lol
0 0
Quincy blackbird1030
03/19/2017 1:51 PM
Explodatorium
really awesome
1 0
me? sethio11
03/19/2017 1:51 PM
Tower of Fate: ????
the gran fying dagger see's all, knows all, has tremendous power and is impenetrable to none
0 0
me? sethio11
03/19/2017 1:00 PM
Tower of Fate: Ascent
5 1
me? sethio11
03/19/2017 12:50 PM
Tower of Fate: Entrance
one step closer to plague of shadows
0 0
Victor Ohmanitsvic
03/19/2017 12:47 PM
Plains
2 0
Victor Ohmanitsvic
03/19/2017 12:44 PM
Plains
0 0
Ryan CreepyCreeper_59
03/19/2017 10:08 AM
Village
I has too much magic. exact number = 80
4 0
Lucariokid Lucariokid101
03/19/2017 9:07 AM
Explodatorium
Watch out for your green copies! they can do anything that you do...exept use magic.
0 0
Harrison Slam-A-coW_624
03/19/2017 8:54 AM
Explodatorium (Plague)
cool game on plague of shadows
2 0
carson carsonshannon
03/19/2017 7:54 AM
Plains
3 0
Jay Jaytr0n
03/19/2017 7:47 AM
Village
5 0
Squeaky Pandas4lyfe2
03/19/2017 5:55 AM
Plains
Cant beat First boss... This is sad
1 1
Squeaky Pandas4lyfe2
03/19/2017 5:53 AM
Plains
This Guy, I SWEAR TO GOD!
0 0
Levi Levetation007
03/19/2017 4:36 AM
Armor Outpost
Ive beat polar knight and man this game is getting good
4 1
Marco ndolphin64
03/19/2017 2:18 AM
Troupple Pond (Plague)
ONE OF THE BEST GAMES I'VE EVER PLAYED!!!!
3 0
Aaron Ottavio24
03/18/2017 11:53 PM
Tower of Fate: Ascent (Plague)
I have more cipher coins than actual treasure due to how many times I've died to those green rats.
1 0
Aaron Ottavio24
03/18/2017 9:57 PM
Stranded Ship (Plague)
Thank God for Wall-chicken!!!
0 0
Aaron Ottavio24
03/18/2017 8:52 PM
Clockwork Tower (Plague)
Tinker Knight's level was harder than he was!
0 0
Aaron Ottavio24
03/18/2017 8:38 PM
Clockwork Tower (Plague)
I've never been so happy to see a checkpoint in my life!
0 0
Aaron Ottavio24
03/18/2017 8:33 PM
Clockwork Tower (Plague)
I miss my shovel!!!
0 0
PIKACHU zamudionot
03/18/2017 8:32 PM
The Lich Yard
finnaly killed specter kighit I feel so acomplished
1 0
PIKACHU zamudionot
03/18/2017 8:28 PM
The Lich Yard
4 0
PIKACHU zamudionot
03/18/2017 8:00 PM
The Lich Yard
0 0
Jamar aikenfamily
03/18/2017 7:47 PM
The Lich Yard
YEAH!i deafeated specter night!
0 0
PIKACHU zamudionot
03/18/2017 7:46 PM
Village
9 0
Jamar aikenfamily
03/18/2017 7:26 PM
The Lich Yard
I thought i would never make to the boss!
1 0
Four eyes Blastbox22
03/18/2017 7:25 PM
Explodatorium
Don't worry about blue spikes; they aren't instant death. What they knock you into though...
0 0
eva Todisco
03/18/2017 5:06 PM
Pridemoor Keep
how do u book jump
4 0
eva Todisco
03/18/2017 4:49 PM
Pridemoor Keep
how do you magic?
2 0
eva Todisco
03/18/2017 4:36 PM
Village
how do you magic?
1 0
eva Todisco
03/18/2017 4:32 PM
Plains
Yes!!!!!!!!!!!!!!!!!!
0 0
eva Todisco
03/18/2017 4:25 PM
Plains
wish luck please : /
0 0
eva Todisco
03/18/2017 4:23 PM
Plains
cant pass last boss on first level. how does his patterns even work??
0 0
cat93860 lepo458
03/18/2017 2:16 PM
Encuentro - Baz
Eccelente batalla bas
3 0
Thomas Lifesvids
03/18/2017 1:53 PM
The Lich Yard
6 1
tommy sprogs
03/18/2017 1:01 PM
Plains
hard
1 1
Francisco Francisco35
03/18/2017 12:53 PM
Clockwork Tower
First try against Tinker Knight!
0 0
Sope sci24680
03/18/2017 12:26 PM
Stranded Ship
Well, the green orb relic worked pretty well polarizing Polar Knight. Haha XD, ok l'll stop.
4 0
Sope sci24680
03/18/2017 12:19 PM
Stranded Ship
So Shovel and Polar are actually friends, and Polar just got "reprogrammed" by Enchantress? Woah!
3 0
Francisco Francisco35
03/18/2017 12:18 PM
Troupple Pond
I finally met the king of apple fish! (I forgot his name)
4 0
Thomas Lifesvids
03/18/2017 10:16 AM
Plains
First time playing shovel knight. This game is awesome!
5 0
bode mountnickles
03/18/2017 8:30 AM
Tower of Fate: Entrance
im desent, no way!
0 0
TheMutant Butt999673
03/18/2017 8:03 AM
Flying Machine
The Mobile gear can block the winds of the fan. Making it easier to get to the room on the right.
6 0
GG BOOW Sonic982006
03/18/2017 7:00 AM
The Lich Yard
hes so esay
3 0
Cubone Birdle48
03/18/2017 6:26 AM
Plains (Plague)
I'm so glad there's no timer...
1 0
nikos fishslapper
03/18/2017 4:49 AM
Stranded Ship
use my rod to get rid of these pesky vikings
2 0
Dave Doodicus_1982
03/17/2017 8:41 PM
Hall of Champions
Hooray for Shovel Knight!
3 0
Simon gamerapper
03/17/2017 7:48 PM
Village
1 0
Robert taydeu
03/17/2017 7:17 PM
Explodatorium
I'm using the infinite ammo and custom knight atl level fifty.
0 0
David dbtdwt
03/17/2017 6:27 PM
Rematch: Phantom Striker
Beat on the first try!
3 0
David dbtdwt
03/17/2017 6:22 PM
Rematch: Reize
Pretty easy! I didn't realize Fleet Flask was such a good weapon before.
0 0
David dbtdwt
03/17/2017 5:56 PM
Rematch: Treasure knight
Yes! First one of these rematch challenges I've beaten with Plague Knight!
0 0
bode mountnickles
03/17/2017 5:16 PM
The Lich Yard
hi
1 0
Ryan Mr.swagger14567
03/17/2017 3:29 PM
Pridemoor Keep
0 0
epic man jimboslice333222
03/17/2017 3:28 PM
Troupple Pond (Plague)
1 0
jay-man jay-vic
03/17/2017 3:07 PM
Plains
rRDRDFDCCVFGVYYFCUFYTYCR HomeF
2 0
kasper Starlord9x9
03/17/2017 2:11 PM
Explodatorium
I beat the plague knight campaign!
4 0
Jack FoxSage
03/17/2017 12:07 PM
Stranded Ship
0 0
Fnaf gaurd avidreader1085
03/17/2017 11:55 AM
Iron Whale
hard with my friend anthany
3 1
Telvyn KingTelvyn
03/17/2017 9:44 AM
Village
how do i talk
1 0
David dbtdwt
03/17/2017 9:43 AM
Fleet Flight
Reminds me of Rayman Legends's running levels, and just as satisfying when I finally do it right!
1 0
nikos fishslapper
03/17/2017 9:13 AM
Pridemoor Keep
WAIT THERES TWO OF ME
1 0
jonah jfixgamer
03/10/2017 11:07 PM
Plains
i love this game!
4 0
GDFanYt GDFanYoutube
03/10/2017 8:10 PM
Plains
This game is a mix of megaman and zelda. I like this game
1 0
NoahHeroic NoahRocker6823
03/10/2017 7:36 PM
Plains (Plague)
BUTT MODE!!!
4 0
NoahHeroic NoahRocker6823
03/10/2017 7:28 PM
Plains (Plague)
im pretty stuck in this level... any guides?
0 0
Marcus ocelot509
03/10/2017 7:26 PM
Plains (Plague)
0 0
NoahHeroic NoahRocker6823
03/10/2017 7:16 PM
Armor Outpost
painkeel, i got some help for ya!
3 0
NoahHeroic NoahRocker6823
03/10/2017 7:13 PM
Village
3 0
MORROWS mohuffken
03/10/2017 6:02 PM
Iron Whale (Plague)
ugh, dead again! im gonna end up losing all me monies!
0 0
luigi isaiah1b
03/10/2017 5:18 PM
Encounter - Reize (Plague)
lol beat him first try
0 0
henry headofmariomaker
03/10/2017 4:04 PM
Plains
0 0
bambee Gbeeboy26
03/10/2017 2:14 PM
Plains
ffgvgff
2 0
Firenose10 firenose10
03/10/2017 1:34 PM
Plains
I just got the game and i already love it!!!!!!!
3 0
Billy Billyboy211
03/10/2017 12:54 PM
Stranded Ship
If you plug in a Mini NES controller to a wii remote you can play on an nes controler
3 0
mike mikeg25
03/10/2017 11:02 AM
Troupple Pond
3 0
Sadie SansaSnark
03/10/2017 10:58 AM
Lost City
If you keep pushing ^&Y after punching a dustblock, you can keep going as long as there are blocks.
2 0
ShamaloDXD shamalo45
03/10/2017 10:28 AM
Plaines (Plague)
Time to beat Plague Knight's campaign in time for the release of Specter Of Torments!
0 0
$weeney dollarsine
03/09/2017 8:42 PM
Village
7 0
Ethan efolzie13
03/09/2017 8:36 PM
Village (Plague)
Where is the third music sheet?
0 0
Fox FoxMcClowd
03/09/2017 5:03 PM
Village
"Watch me dance!" N-no thats alright you don't need to... Lady stop so I can leave!
5 0
Owen rockhead92
03/09/2017 4:54 PM
Tower of Fate: Entrance (Plague)
0 0
Fox FoxMcClowd
03/09/2017 4:46 PM
Encounter - Baz
i hate Baz for the sole reason hes a embarrassing person to be a Belmont
0 0
Jeffrey JeffreyCowboy
03/09/2017 3:35 PM
Plains
Weeeeeeee
2 0
Lipe LipePereira
03/09/2017 3:34 PM
Flying Machine
0 0
Fox FoxMcClowd
03/09/2017 3:33 PM
The Lich Yard
<3 Specter Knight <3
1 0
Fox FoxMcClowd
03/09/2017 3:26 PM
Pridemoor Keep
How many swift beatings have i given King Knight now?
3 0
DaPug21 pugster21
03/09/2017 3:23 PM
Village (Plague)
how do i change armor
0 1
dancerchic Mikewyoboy
03/09/2017 3:15 PM
Village (Plague)
Today i walked into the lair after defeting the spector knight and i saw mona dancing! and smiling!
3 0
Fox FoxMcClowd
03/09/2017 3:15 PM
Pridemoor Keep
Those chandelieres CANNOT be up to code!
3 0
allan voreyes
03/09/2017 2:38 PM
Plains
money money mooony money!!!!
5 0
Fox FoxMcClowd
03/09/2017 2:15 PM
Pridemoor Keep
Knock knock King Knight! I've come for your life!
2 1
Braeden BandEBroductions
03/09/2017 6:48 AM
Armor Outpost
ez pz boss only lost two health
0 0
ook pichu5678
03/09/2017 5:32 AM
Plains
i keep dying!!!!!!
2 0
Cheese DawsonTrio
03/09/2017 4:32 AM
Plains
1 0
Coyote☆ Naeyin
03/08/2017 8:51 PM
Pridemoor Keep
Only two tries, and the king is dead. Too bad he died before I could get my money bags. (-_-)
1 0
Coyote☆ Naeyin
03/08/2017 8:45 PM
Pridemoor Keep
The room with the magical book steps took all my money! LOL
4 0
Julian Necromancer985
03/08/2017 7:41 PM
Armor Outpost (Plague)
Im pretty sure that it coppies what you do as shovel knight, then plays it back. Pretty Cool!
2 0
seb2.0 dan madseb0309
03/08/2017 6:05 PM
The Lich Yard
5 0
Brandon shovelknight9999
03/08/2017 5:34 PM
Plains
god mode is beautiful
0 0
Slenderman bubbalou12
03/08/2017 5:28 PM
Plains (Plague)
hahaHaha
1 0
steven U idiotds
03/08/2017 4:04 PM
Bonus - Pridemoor Keep
I can't wait for a mole knight DLC
4 0
BLKWITCHY BLKWITCHY
03/08/2017 2:38 PM
Plains
Finally 1Boss DOwn How Many More
2 0
BLKWITCHY BLKWITCHY
03/08/2017 2:34 PM
Plains
0 0
Adversary Matthew_Fritz
03/08/2017 2:30 AM
Iron Whale (Plague)
The Greedy Knight shall get a big.... BOOM! HEE HEE HEE
1 0
Zuchuato ezenteno
03/07/2017 9:49 PM
Tower of Fate: ????
4 0
Chris Brewer8318
03/07/2017 9:02 PM
Plains
2 0
Mustard krazytodd
03/07/2017 5:19 PM
Flying Machine
Yes!!!! I defeated the most fabulous video game character ever!!!
2 0
Mustard krazytodd
03/07/2017 5:01 PM
Flying Machine
0 0
Mustard krazytodd
03/07/2017 4:53 PM
Flying Machine
Quick!! Start fishing here to heal.
0 0
emry emrynewbz
03/07/2017 4:07 PM
Stranded Ship
'Spoilers' button or not, it's made my last 2 hours prettty, prettty, preeety spoiled.
9 0
Kelton Yoshi_2_21
03/07/2017 3:45 PM
Plains
i want to die
4 0
pichonsito fabianelmejor
03/07/2017 2:37 PM
Campiña
2 4
Tom leonidasdecree
03/07/2017 8:48 AM
Village
1 0
Jai JAINITZ
03/07/2017 4:51 AM
Village
I didn't know I had my own James Bond movie!
0 0
Crisss_256 Cris_256
03/06/2017 10:16 PM
Villa
Jugando con el Polca Shovel Knight
1 0
Shaheem starshah
03/06/2017 8:08 PM
Plains
beyond worth my money
1 0
shane shaneous32
03/06/2017 7:58 PM
The Lich Yard
1 0
Thatguy skywarrior64
03/06/2017 4:07 PM
The Lich Yard
Why specter knight hired frogs for his army, we'll never know.
9 0
lando Frijolitolando
03/06/2017 2:59 PM
Tower of Fate: Ascent
1 0
leon butt LeonTheDestroyer
03/06/2017 2:33 PM
Pridemoor Keep
fruhyut'rvjkgwehwrofjqoqkto@mhprjd?lk
2 0
leon butt LeonTheDestroyer
03/06/2017 2:29 PM
Pridemoor Keep
afjdjk
2 0
Kohen kkmac13
03/06/2017 12:32 PM
Village
now I have 20 health!as much as a boss battle.
2 3
KingMob Stoinsh
03/06/2017 9:03 AM
Lost City (Plague)
0 0
Burner BMTrick
03/05/2017 5:12 PM
Encounter - Reize
Wooo!!! choas ball!
0 0
KingMob Stoinsh
03/05/2017 4:03 PM
Clockwork Tower (Plague)
oi
0 0
KayKay v01dwalk3r
03/05/2017 1:59 PM
Lost City
the mole knight is fat and ugly thats why he lost to me!!!!
0 0
KayKay v01dwalk3r
03/05/2017 1:04 PM
Plains
i love this game times bigillion!!!!!!!!
5 0
Nixon 111111nixon
03/05/2017 12:56 PM
The Lich Yard
Im stuck
7 0
Burner BMTrick
03/05/2017 12:34 PM
Plains
STEEL THY SHOVEL!!!
1 0
Burner BMTrick
03/05/2017 12:33 PM
Plains
FOR SHOVELRY
0 0
Burner BMTrick
03/05/2017 12:31 PM
Plains
For Shovelry
2 0
Juan Sebas sebasiq840
03/05/2017 11:46 AM
Encuentro - Baz
baz es bastane débil
0 0
mii mommaclemens
03/05/2017 11:41 AM
Plains
6 1
Juan Sebas sebasiq840
03/05/2017 11:40 AM
La Ciudad Perdida
mole knight derrotado
1 0
mii mommaclemens
03/05/2017 11:38 AM
Plains
i know i post a lot but i like to draw ok?
2 0
mii mommaclemens
03/05/2017 11:36 AM
Plains
2 0
mii mommaclemens
03/05/2017 11:32 AM
Plains
1 0
mii mommaclemens
03/05/2017 11:30 AM
Plains
1 0
mii mommaclemens
03/05/2017 11:29 AM
Plains
1 0
mii mommaclemens
03/05/2017 11:23 AM
Plains
0 0
mii mommaclemens
03/05/2017 11:15 AM
Plains
ooooooo
1 0
Teferi Laephis
03/05/2017 10:18 AM
Troupple Pond
Dig my grave!
6 0
Fenner fennaynays
03/05/2017 10:02 AM
Village
why is the amibbo never used in any other game!
5 0
mason tsenswampy12
03/05/2017 9:58 AM
Encounter - Baz
you can continue to beat up baz after beating him
2 0
mason tsenswampy12
03/05/2017 9:56 AM
Encounter - Baz
too easy
0 0
mason tsenswampy12
03/05/2017 9:42 AM
Encounter - Reize
thats what you get for attacking an innocent good guy
0 0
T-Dex pletcher4
03/05/2017 9:33 AM
The Lich Yard
2 0
Jay Jaytr0n
03/05/2017 7:52 AM
Clockwork Tower
We must climb the tower!
0 1
Jay Jaytr0n
03/05/2017 7:42 AM
Stranded Ship
Day 7 Snow started to fall after the defeat of Polar Knight, as if nature was mourning for his loss.
2 0
Jay Jaytr0n
03/05/2017 7:38 AM
Hall of Champions
I found Egoraptor and JonTron!
0 1
Ealy PaintingFire
03/05/2017 6:33 AM
Flying Machine
Is it just me, or is Propeller Knight actually a tough boss?
0 0
revex pokemaster258
03/05/2017 5:41 AM
Pridemoor Keep
omg
0 0
Evan Dragoncrafter456
03/05/2017 5:15 AM
Lost City (Plague)
if you hit the dinosaur's nose you get food
2 0
Sope sci24680
03/04/2017 8:14 PM
Lost City
Mole Knight was pretty fun to battle. If you really get his pattern, he's not too hard of a boss.
0 0
Charlie caj8988
03/04/2017 8:13 PM
Plains
Easy Peasy Lemon Squeeze
0 0
Charlie caj8988
03/04/2017 8:10 PM
Plains
Easy Peasy Lemon Squesy
1 0
Charlie caj8988
03/04/2017 8:06 PM
Plains
Just started agin alread beat it though heuheuheu.
0 0
Ethan efolzie13
03/04/2017 7:40 PM
Pridemoor Keep (Plague)
Replaying for completion!!
3 0
$ilvertail Silvertailsbea
03/04/2017 7:21 PM
The Lich Yard
succ
0 0
$ilvertail Silvertailsbea
03/04/2017 6:49 PM
The Lich Yard
succ
0 0
Destiny DestinyIntwined
03/04/2017 5:20 PM
Lost City
So I deleted my game...
2 0
MORROWS mohuffken
03/04/2017 5:09 PM
Clockwork Tower
I HATE THIS FREAKING LEVEL!
4 0
$ilvertail Silvertailsbea
03/04/2017 5:04 PM
The Lich Yard
succ
0 0
Dane blacksilver7
03/04/2017 5:00 PM
Explodatorium (Plague)
Its so funny trapping shovel knight in a pit and just lobbing bombs at him while the AI is just dumb
3 0
Dane blacksilver7
03/04/2017 4:56 PM
Explodatorium (Plague)
Its kinda weird having Plague Knight go through his own stage :Y
2 0
Christian christianjoshua
03/04/2017 2:36 PM
Plains (Plague)
heehehe
0 0
Michael gravityrestraint
03/04/2017 1:12 PM
Explodatorium
Digging this game so far!
1 0
Nicholas Jacksepticeye239
03/04/2017 1:11 PM
Encounter - Baz
Baz is a loser
4 0
joe kevinyap1
03/04/2017 12:33 PM
Village
hi
3 0
joe kevinyap1
03/04/2017 12:30 PM
Pridemoor Keep
two down
0 0
joe kevinyap1
03/04/2017 11:57 AM
Plains
Yess one down
1 0
Nick n.2007
03/04/2017 11:19 AM
Troupple Pond
thy this iws the best ceremony known to men
2 0
Nick n.2007
03/04/2017 11:15 AM
Troupple Pond
troupleking!!!!???
0 0
Nick n.2007
03/04/2017 11:15 AM
Troupple Pond
ummm...?
0 0
Nick n.2007
03/04/2017 11:14 AM
Troupple Pond
i beat king knight!!!
1 0
dio caroline_unique
03/04/2017 10:09 AM
Pridemoor Keep
1 0
nillad jdawgs7
03/04/2017 9:50 AM
Plains
getting money is my thing
0 0
sans lalospace
03/04/2017 9:40 AM
Vuelo Glacial
0 1
Arlo bungeroo
03/04/2017 6:55 AM
Plains
zfgdvf
2 0
alexplayZ Alexander0325
03/04/2017 6:42 AM
The Lich Yard
Specter Knight, you're going down!
6 0
Austin taylorfox123
03/04/2017 6:38 AM
The Lich Yard
FINALLY
0 0
Austin taylorfox123
03/04/2017 6:22 AM
The Lich Yard
2 0
randomman Pieeliminator
03/04/2017 5:53 AM
Plains
Really Fun!!!
0 0
The Fred pfeiffer1111
03/04/2017 5:53 AM
Tower of Fate: Entrance
I'm dead if i'm a pixel of !!!!!!!!!!
1 0
Kaden ahayes202
03/04/2017 5:02 AM
The Lich Yard
jeez specter knight is hard. can someone give me some tips?
1 0
Joshie How_About_BEANS
03/03/2017 10:32 PM
Tower of Fate: Ascent
Wow, Tower of Fate on new game plus is tough. This'll take a couple of hours..
2 0
Herchu Herchu
03/03/2017 8:22 PM
Fortaleza del Orgullo
Segundo jefe de este gran juego¡¡¡
2 0
Faheem fmjr13
03/03/2017 8:19 PM
Plains
game is good so far!
1 0
Sope sci24680
03/03/2017 7:19 PM
Lost City
Green goo that makes lava bungy jumpy. Pretty neat
4 0
★☆Theif!☆★ joejoe4life
03/03/2017 7:13 PM
Encounter - Black Knight (Plague)
WHA- BLACK KNIIIIIIIGHT!!! Y U HAVE FALSE OPINION!!!!
3 0
Lee Lee115
03/03/2017 7:09 PM
The Lich Yard
I made him give up the ghost.
8 0
Sope sci24680
03/03/2017 7:07 PM
Village
Sure feels like Zelda II whenever I go to the village(not that I played it :3)
5 0
Lee Lee115
03/03/2017 6:48 PM
Pridemoor Keep
0 0
Mark Happyguy2
03/03/2017 6:21 PM
Stranded Ship
yeahhhhhh
0 0
★☆Theif!☆★ joejoe4life
03/03/2017 6:03 PM
Pridemoor Keep (Plague)
Siked for "Specter Night"
2 0
Jay Jaytr0n
03/03/2017 6:02 PM
Iron Whale
Level COMPLETE!!!
0 0
Jay Jaytr0n
03/03/2017 5:55 PM
Iron Whale
Treasure Knight looks like he's from Bioshock
6 0
Dan TDM 123zander123
03/03/2017 4:30 PM
Plains
Hi
1 3
nillad jdawgs7
03/03/2017 3:38 PM
The Lich Yard
k this is very harrd
2 0
Nina IcarusFanNina
03/03/2017 2:47 PM
Iron Whale
beat 3 bosses so far plague knight, treasure knight and a boss traveler. Maybe 2 boss travelers
3 0
King JJ lilsilver96
03/03/2017 1:48 PM
Pridemoor Keep
1 0
Emiko PopStarBlaze
03/03/2017 1:01 PM
Lost City
Do not even try to attack Mole Knight when he's like this, just do not. You'll only get hurt.
1 0
Nina IcarusFanNina
03/03/2017 12:18 PM
Explodatorium
finally beat plague knight, took me literally forever
3 1
nimrod nimrod89
03/03/2017 11:14 AM
Plains (Plague)
Greetings fellow knights. I have a question to ask you: what is your favorite cheat in the game?
2 0
Dani Oh_Boy_08
03/03/2017 11:02 AM
Tower of Fate: Entrance
Difficult
0 0
PK Paul.MN
03/03/2017 9:23 AM
Explodatorium
gffwjdygdkggphgof
3 0
Obsa :3 KanjiMage64
03/02/2017 8:03 PM
Torre del Hado: ???? (Plague)
Ohhhhh!!!!!
2 0
Obsa :3 KanjiMage64
03/02/2017 7:38 PM
Torre del Hado: Ascensión (Plague)
WHAT????????!!!!!
1 0
Nick n.2007
03/02/2017 6:17 PM
Plains
hey auturisk
1 0
Nick n.2007
03/02/2017 6:02 PM
Plains
sup
5 2
Chris chris_mingus
03/02/2017 5:55 PM
Pridemoor Keep
Old-time 8-bit platforming heaven.
5 1
Mr.Leo Gahoondy
03/02/2017 5:31 PM
Explodatorium
I finally beat plaug night
0 0
Mr.Leo Gahoondy
03/02/2017 5:13 PM
Explodatorium
Just beat treasure night
2 0
colin awesomepokmon
03/02/2017 4:42 PM
Village
got the dust knuckles!!!
4 0
Matt drago4077
03/02/2017 4:40 PM
Plains
nohjffuhvch
2 0
colin awesomepokmon
03/02/2017 4:37 PM
Plains
YO
3 0
Mark Happyguy2
03/02/2017 3:47 PM
Village
Hey whats up
1 0
gracie nightsofthedawn4
03/02/2017 3:26 PM
Plains
love this game :)
0 0
sonicspeed sonicspeed_fast
03/02/2017 2:39 PM
Stranded Ship
the boss was easy for me
0 0
Joey krawky398
03/02/2017 1:22 PM
The Lich Yard
Nearly no deathed my way through, but got Ninja Gaiden'd into a pit at the end. Darn.
0 0
Joey krawky398
03/02/2017 1:06 PM
Pridemoor Keep
Heck yeah, winning with a fishing pole. The best.
0 0
Obsa :3 KanjiMage64
03/02/2017 12:57 PM
Villa (Plague)
Mona es muy linda :)
2 0
Joey krawky398
03/02/2017 12:39 PM
Village
The theme for Mona's game is really good.
4 0
Joey krawky398
03/02/2017 12:34 PM
Plains
Even if I have the PC version, had to nab the Wii U version too. Co-op and Custom Knight, heck yeah!
1 0
Joey krawky398
03/02/2017 12:30 PM
Plains
Don't forget your free cooked ground chicken!
2 0
Rellmon Rellmon
03/01/2017 10:35 PM
Lost City
Yes!!!
2 0
Kris rainbowcheckers
03/01/2017 6:51 PM
Plains
4 0
n.W.s theredpyramid
03/01/2017 5:24 PM
The Lich Yard
i am win
0 0
FACU nicolasxp5
03/01/2017 5:09 PM
Villa
QUE ES ESA COSA
0 0
Keagen 494829
03/01/2017 5:09 PM
Village
People say Shovel knight is 8-bit when obviously it is 16-bit :/
5 0
n.W.s theredpyramid
03/01/2017 4:59 PM
Plains
1 0
Mathias MathCer
03/01/2017 4:53 PM
Armería
19 0
Riley PrincessRGG
03/01/2017 4:14 PM
Plains
I will Rule!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
0 0
Riley PrincessRGG
03/01/2017 4:02 PM
Plains
1 0
liam Fishey21
03/01/2017 3:17 PM
Tower of Fate: Ascent (Plague)
robo dance
3 1
Wesley GorohKirby
03/01/2017 2:57 PM
Plains
2 0
Wesley GorohKirby
03/01/2017 2:53 PM
Plains
3 0
Jeff nicetryman
03/01/2017 11:31 AM
Plains
0 0
undetale egnNcbhbdffh
03/01/2017 10:11 AM
Armería
0 0
undetale egnNcbhbdffh
03/01/2017 10:08 AM
Armería
skeletons!!
0 0
undetale egnNcbhbdffh
03/01/2017 9:14 AM
Villa
0 0
A-mari fruitseed8
03/01/2017 9:06 AM
Plains (Plague)
0 0
Rangel JosibiusZ
02/28/2017 9:17 PM
Plains
I can now see why people went nuts with this game, it is awesome!
3 0
Craft Craft_Mesa
02/28/2017 9:12 PM
Village (Plague)
Craft's log 1: currently on the path to take down the Enchantress, wish me luck.
2 0
starflight starflight894
02/28/2017 7:45 PM
The Lich Yard
Frustrating boss number one: Specter Knight
4 1
starflight starflight894
02/28/2017 7:16 PM
Troupple Pond
One of my favorite characters in the game is the troupple king, he's adorable
3 2
Nathan MoodyBlues
02/28/2017 6:54 PM
The Lich Yard
good luck!
1 0
chris AtomicRiolu
02/28/2017 6:51 PM
Clockwork Tower
Really hard stage, easy phase 1, epic phase 2, welcome to Shovel Knight.
0 0
chris AtomicRiolu
02/28/2017 6:41 PM
Clockwork Tower
I suck at this stage... but its fun, so Im not angry! Good on you, Yacht Club Games!
0 0
chris AtomicRiolu
02/28/2017 6:27 PM
Clockwork Tower
This stage. <3
2 0
Endymion Endymion_Osiris
02/28/2017 5:59 PM
Iron Whale
super easy level
4 2
colin awesomepokmon
02/28/2017 5:32 PM
Troupple Pond
2 0
gabo gamerprocr2016
02/28/2017 5:03 PM
Tower of Fate: Ascent (Plague)
0 1
Gregor Gregor82
02/28/2017 4:45 PM
Pridemoor Keep
Death Toll: Dark means death in: The lich yard
2 0
A-mari fruitseed8
02/28/2017 1:36 PM
Plains
Vegetation Knight Powers
1 0
A-mari fruitseed8
02/28/2017 1:31 PM
Plains
The easter egg worked! type name as ' X&BUTT'
0 0
Zero Zero_Kase
02/28/2017 8:26 AM
Villa (Plague)
ya me acabe el juego de shovel knigt en modo dificil y el de plague knigt tambien
3 0
Mewtwo mewtwoORjt
02/28/2017 7:10 AM
Iron Whale
ahhh ankers of his are killing me!
0 0
MartinMG martinsebastian4
02/27/2017 8:30 PM
Troupple Pond
The Troupple King im your BIGGEST fan!
1 0
BaubhBee Bobby_Z.3
02/27/2017 8:15 PM
Plains
Cocky sukiyaki
0 0
matt Msds1988
02/27/2017 7:45 PM
Stranded Ship
awesomesause just beat cold knight or whatever his name is.
10 0
RODRIGO rohero
02/27/2017 7:13 PM
Clockwork Tower (Plague)
SUCC
0 0
RODRIGO rohero
02/27/2017 7:03 PM
Village (Plague)
SUCC
1 0
RODRIGO rohero
02/27/2017 7:03 PM
Village (Plague)
SUCC
1 0
eric espp05
02/27/2017 4:59 PM
Campiña
gg dark night
0 0
Tommy Tackledsteak6
02/27/2017 4:59 PM
Tower of Fate: Ascent
oh gosh, so many bosses in one dungeon, wish me luck
2 0
Brandon shovelknight9999
02/27/2017 4:54 PM
Hall of Champions
best portrait of arin
0 0
#BT bendy danielischeese
02/27/2017 4:38 PM
Stranded Ship
first day here on titan mode. everything is so small
1 0
Gregor Gregor82
02/27/2017 4:32 PM
The Lich Yard
0 0
Gregor Gregor82
02/27/2017 4:28 PM
The Lich Yard
0 0
Gregor Gregor82
02/27/2017 4:23 PM
The Lich Yard
0 0
Gregor Gregor82
02/27/2017 4:19 PM
The Lich Yard
SOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO hard
0 0
Spike raven.titan
02/27/2017 2:51 PM
Plains
1 0
★♪Chara♪★ Barbibulle157
02/27/2017 2:29 PM
Forêt du Phasage
Comment je pourais "phaser"?
1 0
Mario1130 JohnM1130
02/27/2017 2:16 PM
Armor Outpost
They should've added a link boss to fight so that you can have a link themed armor.
6 2
Raph Blatj16
02/27/2017 1:23 PM
Encounter - Black Knight
Got him down!
0 0
Roosevelt potato3
02/27/2017 12:44 PM
Lost City (Plague)
to whomever may be reading this: mole knight and his stage is a pushover
0 0
Roosevelt potato3
02/27/2017 9:53 AM
The Lich Yard (Plague)
to beat specter knight: lob casing, black powder and standard fuse. you're welcome.
2 0
Roosevelt potato3
02/27/2017 9:31 AM
The Lich Yard (Plague)
fighting specter knight as plague knight is terrible!
12 1
ShadowMax8 Shadowmax889
02/27/2017 7:48 AM
Villa
excelente juego
2 0
Roosevelt potato3
02/27/2017 7:30 AM
Plains (Plague)
I finally beat black knight in plague of shadows!
0 0
Roosevelt potato3
02/27/2017 7:08 AM
Plains (Plague)
plague knight = crazy hard to control
0 0
dominick dominick2409
02/26/2017 9:18 PM
Villa (Plague)
odio shadow knigt el hizo que mona se fuera a otro lugar
1 0
Shawn AtmaDev
02/26/2017 7:12 PM
Encounter - Baz (Plague)
This is just.... oh... so good!
0 0
Ty twiggiestpanda
02/26/2017 5:57 PM
The Lich Yard (Plague)
new game plus is hard =(
4 0
Bob SappyClone
02/26/2017 5:34 PM
Pridemoor Keep
The king was no match for my mighty shovel!
0 0
MartinMG martinsebastian4
02/26/2017 4:41 PM
Tower of Fate: Ascent (Plague)
Me too!
1 0
MartinMG martinsebastian4
02/26/2017 4:15 PM
Tower of Fate: Ascent (Plague)
room done
1 0
T-Dex pletcher4
02/26/2017 3:36 PM
Village
0 0
MartinMG martinsebastian4
02/26/2017 3:34 PM
Tower of Fate: Entrance (Plague)
i made room..
1 0
Tyler ttrott
02/26/2017 3:24 PM
Forest of Fishing (Plague)
Help
2 0
charmander marcelm10
02/26/2017 2:13 PM
Armor Outpost
I didnt know he's a bad guy and a boss!
2 0
Don Jr DonMichael
02/26/2017 12:24 PM
Plains
dark kight is easy on one player
4 0
kaimana kaimanaf
02/26/2017 12:13 PM
Tower of Fate: Entrance
1 0
colin awesomepokmon
02/26/2017 11:43 AM
Pridemoor Keep
about to face king knight
1 0
Heavy Heavy1984
02/26/2017 11:09 AM
The Lich Yard
easy boss
0 0
D manutd5
02/26/2017 11:08 AM
The Lich Yard
The parts that go dark are rough.
8 0
ozono ozono3ds
02/26/2017 10:20 AM
Fortaleza del Orgullo
Hola! Me gusta el caballero Shovel
2 0
sbbudder corran04
02/26/2017 9:50 AM
Lost City
how do you beat this boss????????????? ????? ??
0 0
Evan PhoenixFalling
02/26/2017 9:45 AM
Village (Plague)
ola
1 0
undetale egnNcbhbdffh
02/26/2017 9:34 AM
Campiña (Plague)
0 0
MartinMG martinsebastian4
02/26/2017 9:26 AM
Lost City (Plague)
lel i suck
2 0
MartinMG martinsebastian4
02/26/2017 9:15 AM
Lost City (Plague)
Tip Bottom Orbit Castin!
1 0
MartinMG martinsebastian4
02/26/2017 8:44 AM
Explodatorium (Plague)
yes...
0 0
Tyler ttrott
02/26/2017 8:41 AM
The Lich Yard
Hit Him When he does not have his sycthe
1 0
MartinMG martinsebastian4
02/26/2017 8:39 AM
Explodatorium (Plague)
room
1 0
Tyler ttrott
02/26/2017 8:18 AM
The Lich Yard
1 0
Mario123 cuttbutt
02/26/2017 6:38 AM
Plains
hi
0 0
€®Vϊñçéňт VJOSmith9
02/26/2017 6:36 AM
The Lich Yard
How do i use magic?
1 0
Matt Kyle mattkyle
02/25/2017 10:41 PM
Plains
Shovel Knight on sale...had to buy it again...and ill get it a third time on switch too!
4 0
Carlos cugizar88
02/25/2017 9:56 PM
Fortaleza del Orgullo
Que buena vaina esta este juego!!! la mera tos con flema :)
0 0
sbbudder corran04
02/25/2017 8:52 PM
Pridemoor Keep
how to best 2nd boss
0 0
sbbudder corran04
02/25/2017 8:21 PM
Plains
how do you best the first boss
0 0
Austin Link.MLG
02/25/2017 6:52 PM
Plains
I finally got this game!
3 1
nicholas megapizzaman
02/25/2017 5:46 PM
Clockwork Tower
His part 2 is so annoying
3 0
erik erock25622
02/25/2017 5:35 PM
The Lich Yard
kill me
3 0
mattman ultimatematty123
02/25/2017 4:42 PM
Forest of Phasing
i need help gettingpast this part
5 1
andres andresDR12
02/25/2017 4:31 PM
Finca de Liches
estoy jugando shovel khininght es un juego bacano
0 0
Jason jlovin
02/25/2017 4:14 PM
Armor Outpost
fun game
4 0
nicholas megapizzaman
02/25/2017 4:10 PM
Clockwork Tower
would meta knight and black knight be friends?
2 0
Cole 2Cones
02/25/2017 3:58 PM
The Lich Yard
i am dead
3 0
Simon SimonCottam
02/25/2017 3:44 PM
The Lich Yard (Plague)
this is the worst level ever spector knight plague of shodows
3 0
Aedan egl789
02/25/2017 3:30 PM
Explodatorium
if you dont use the invincibility locket you could be litterally insane
3 2
DarkKnight TheBarkleys
02/25/2017 2:37 PM
Dirt Clod Dive
after 10000 attempts i did it
0 0
DarkKnight TheBarkleys
02/25/2017 2:25 PM
Explodatorium (Plague)
he's gonna kill me
0 0
DarkKnight TheBarkleys
02/25/2017 2:16 PM
Village (Plague)
i've waited so long for this... spectre of torment is coming... no more wait until spring of 2017...
2 0
DarkKnight TheBarkleys
02/25/2017 2:14 PM
Village (Plague)
science log: the day that the escence machine broke, 2017 a long day of useless junk i am done today
2 0
Nick CookiesKids
02/25/2017 2:10 PM
Tower of Fate: ???? (Plague)
Wheeeeeeee!
1 0
DarkKnight TheBarkleys
02/25/2017 2:09 PM
Village (Plague)
NEVER WOULD I BE MORE EXITING MORE THAN SPECTRE OF TORENT
4 0
Nick CookiesKids
02/25/2017 2:08 PM
Tower of Fate: Ascent (Plague)
I stole shovel knight's money!! Yay!
3 0
Nick CookiesKids
02/25/2017 2:03 PM
Tower of Fate: Ascent (Plague)
Late to dinner again?!?
3 0
Don Jr DonMichael
02/25/2017 1:59 PM
Village
2 0
Nick CookiesKids
02/25/2017 1:53 PM
Tower of Fate: Entrance (Plague)
okeydoke
1 0
charmander marcelm10
02/25/2017 1:46 PM
Encounter - Baz
3 0
Elijah elijahdudeman
02/25/2017 1:21 PM
Clockwork Tower
boi how do u get past this part
0 0
alan alanmajalca
02/25/2017 1:20 PM
Torre del Hado: Entrada
boi a pasar el juego
2 0
D manutd5
02/25/2017 12:21 PM
Pridemoor Keep
Love this game!
1 1
nick namice
02/25/2017 11:45 AM
Village
1 0
charmander marcelm10
02/25/2017 10:52 AM
Pridemoor Keep
1 0
nicholas megapizzaman
02/25/2017 10:42 AM
Stranded Ship
there needs to be more comments
0 1
joey KyleHill97
02/25/2017 10:03 AM
Plains
0 0
Pro. Oak Iowarulez
02/25/2017 8:55 AM
Village
Watch me dance
1 0
George Geonaruto
02/25/2017 7:16 AM
The Lich Yard
SUCK IT SPECTER KNIGHT
0 0
Beny SucoxMaster
02/25/2017 7:14 AM
Campiña
Jefe, cuidado!
2 0
George Geonaruto
02/25/2017 7:13 AM
The Lich Yard
ONE HIT LEFT AND I DIED YOU GHOSTLY PIECE OF GARBAGE
7 0
George Geonaruto
02/25/2017 7:10 AM
The Lich Yard
SPECTER KNIIIIIIIIIGHT!!!!!!
0 0
dame damefair
02/25/2017 7:03 AM
Pridemoor Keep
i cannot beat him god damnmit
1 0
dame damefair
02/25/2017 7:01 AM
Pridemoor Keep
damn im stuck
0 0
George Geonaruto
02/25/2017 6:55 AM
Troupple Pond
All hail Troupple King! King of trout, apple, and everything inbetween!
2 5
George Geonaruto
02/25/2017 6:47 AM
Plains
Remember to bury those campfires!
1 0
Gold fredbear2003
02/25/2017 5:34 AM
Clockwork Tower
specter knight could total destroy dark knight
2 0
KINGCRIMSN Pwn3r37
02/24/2017 8:12 PM
Plains
STEEL THY BUTT
0 0
compostman urielmilligan
02/24/2017 5:02 PM
Iron Whale
nooooooooooo
3 0
tuko arturo29
02/24/2017 4:15 PM
Villa
wazaaaaaaaa
4 0
Cole 2Cones
02/24/2017 4:01 PM
Plains
same here
1 0
Mikey PandaGuy252
02/24/2017 3:44 PM
Village
0 0
guy watchdoghunter
02/24/2017 2:59 PM
Iron Whale
warning insta death below
1 0
Axel KissMineAxe
02/24/2017 2:55 PM
Village (Plague)
the catapult will not shoot me to the armor outpost >:( shovel knight would dab >-_->
2 0
L↑jpt JuanPablo5
02/24/2017 2:40 PM
Fortaleza del Orgullo
kk
3 0
Eduardo:] infinitum2wlc
02/24/2017 2:12 PM
Villa
difícil pero hermoso
1 0
Eian The_Koppalings
02/24/2017 12:43 PM
Flying Machine
Gr8 M8
0 0
joe ilikesonic21
02/24/2017 5:15 AM
Clockwork Tower
im cheating?
2 0
Nick CookiesKids
02/23/2017 6:51 PM
Encounter - Black Knight (Plague)
*Plague knight intensifies*
3 0
Nick CookiesKids
02/23/2017 6:43 PM
Troupple Pond (Plague)
*Gets pandemonium cloak* Yassss randomized! no longer having to choose stuff
4 0
Nick CookiesKids
02/23/2017 6:38 PM
Village (Plague)
Just annoying the guard... normal days!
3 0
lanbo06 lanbo06
02/23/2017 3:58 PM
The Lich Yard
seen lich yard on videos and its fun
3 0
kyle adenjohn05
02/23/2017 3:57 PM
Village (Plague)
hi
2 0
undetale egnNcbhbdffh
02/23/2017 2:42 PM
Fortaleza del Orgullo
2 0
Katthew Miles523
02/23/2017 1:18 PM
Armor Outpost
NICE HAT!!
0 0
Katthew Miles523
02/23/2017 1:14 PM
Iron Whale
EASY!!! FIRST TRY!
0 0
DarkMaster ACY4dad
02/23/2017 1:11 PM
The Lich Yard
i beat the 2 boss
0 0
Bubbles kvanwyn
02/23/2017 12:01 PM
Village
the memes are going to happen
4 0
Bubbles kvanwyn
02/23/2017 11:59 AM
Village
intenseness intensifies
2 0
Cucho andresjensen
02/23/2017 4:46 AM
Fortaleza del Orgullo
1 0
Brandon shovelknight9999
02/22/2017 8:37 PM
Stranded Ship
phase locket and chaos orb are your friends here
0 0
lucas ONEOFAKIND123219
02/22/2017 8:12 PM
Tower of Fate: Entrance
1 0
Blake scooterthebull
02/22/2017 5:53 PM
Pridemoor Keep
yes you can do 2 players you need the shovel knight amibo
0 1
Nick CookiesKids
02/22/2017 4:54 PM
Gear Grinder
TREASSSURRREEE!!!!!!! YES!
0 0
Katthew Miles523
02/22/2017 4:37 PM
The Lich Yard
Left is right, not just in King Knight's stage.
0 0
Nick CookiesKids
02/22/2017 4:32 PM
Tower of Fate: Entrance (Plague)
When you decide to cheat for this one profile...
1 0
Katthew Miles523
02/22/2017 4:24 PM
Pridemoor Keep
EASY PEASY LEMON SQUEEZY
0 0
Katthew Miles523
02/22/2017 3:53 PM
Plains
First try!!
0 0
Braxy AmazingPuppy9061
02/22/2017 1:47 PM
Tower of Fate: ????
I BEAT THE ENCHANTRESS
0 0
Brett Brettwarrior
02/22/2017 1:01 PM
Plains
Defeated the black knight. He injured me a bit, but it was just a flesh wound.
3 0
tom mkbudd
02/22/2017 12:50 PM
Iron Whale
wow, i just spent all my gold on my shovel abilities, and i have no idea how to use them!
2 0
Link abdielyadrian
02/22/2017 11:35 AM
Lost City
l Lost So Moch GOLD
8 0
Albert Superman200x
02/21/2017 10:33 PM
Plains (Plague)
I for got that they updated the game time to play some shovel knight withplaugs
2 0
bobbo1420 bobbo1420
02/21/2017 8:52 PM
Pridemoor Keep
Fun game
4 0
Justin justlawr
02/21/2017 8:18 PM
Village
life
1 0
Julian Necromancer985
02/21/2017 8:02 PM
Tower of Fate: ????
well THAT explains how I missed five XD
5 0
DDVG MSDollar
02/21/2017 4:21 PM
Plains (Plague)
4 0
undetale egnNcbhbdffh
02/21/2017 12:46 PM
Ballena de Hierro (Plague)
0 0
Tanoo tanoo2002
02/21/2017 11:24 AM
Village
1 0
Modern mordeshake
02/20/2017 7:23 PM
Plains (Plague)
Picking the game back up after 2 years, still a magnificent blast to play! Plague Knight amiibo plz?
3 0
Liam Nucliam
02/20/2017 6:43 PM
Village (Plague)
OMG! I JUST FOUND OUT ABOUT SPECTER OF TORMENT! LET THE HYPE BEGIN!
6 0
Aeneas ehseezee
02/20/2017 6:09 PM
Flying Machine
half a life and i die
1 0
kyle adenjohn05
02/20/2017 5:15 PM
The Lich Yard (Plague)
me to
0 0
Jackson vanwaveren
02/20/2017 4:39 PM
Explodatorium
I watch game grumps play this game, and they always make it seem harder than it really is.
4 0
decky dexauden
02/20/2017 3:23 PM
Village
I love this game
2 0
decky dexauden
02/20/2017 3:21 PM
Village
I love this game
0 0
DarkMaster ACY4dad
02/20/2017 2:39 PM
Pridemoor Keep
can u do 2 players
1 1
DarkMaster ACY4dad
02/20/2017 2:38 PM
Pridemoor Keep
cool
0 0
luisale giovaz84
02/20/2017 1:43 PM
Campiña
)-:
3 0
Evono pikalink16
02/20/2017 1:13 PM
Clockwork Tower (Plague)
FINALLY IM FREE FROM THAT PIT OF HELL
0 0
Jeff Jcrow323
02/20/2017 12:58 PM
Explodatorium
2 0
Julian Necromancer985
02/20/2017 11:57 AM
Plains (Plague)
I literally just threw potions from the corner
0 1
Julian Necromancer985
02/20/2017 10:49 AM
Tower of Fate: ????
1 0
Julian Necromancer985
02/20/2017 9:13 AM
Forest of Phasing
4 0
Kohen kkmac13
02/20/2017 9:11 AM
Pridemoor Keep
I FINALY beet king knight!
0 0
Kohen kkmac13
02/20/2017 9:01 AM
Pridemoor Keep
king knight is so HARD!
3 0
Julian Necromancer985
02/20/2017 8:58 AM
Stranded Ship
In my opinion, hardest so far
0 0
Julian Necromancer985
02/20/2017 8:33 AM
Encounter - Phantom Striker
pearls :|
0 0
N8WiiU Noobz3
02/20/2017 8:30 AM
Encounter - Reize
3 0
Temmie kgibso01
02/20/2017 8:23 AM
Plains
First boss doe
2 0
N8WiiU Noobz3
02/20/2017 8:13 AM
Lost City
3 0
N8WiiU Noobz3
02/20/2017 8:03 AM
Lost City
3 0
Julian Necromancer985
02/20/2017 7:58 AM
Clockwork Tower
if you keep standing on the gear platform, eventually the other platform can glitch you inside :)
1 0
Julian Necromancer985
02/20/2017 7:46 AM
Clockwork Tower
boink, boink, boink
0 0
Nash betonash
02/20/2017 5:39 AM
Finca de Liches (Plague)
2 0
nicholas megapizzaman
02/20/2017 4:59 AM
Lost City
5 0
luigi isaiah1b
02/20/2017 4:28 AM
Tower of Fate: Entrance
holy cow he is mad
2 1
luigi isaiah1b
02/20/2017 3:53 AM
Flying Machine
you need relic that makes you unhitable fer a cople of secs
1 0
luigi isaiah1b
02/20/2017 3:44 AM
Flying Machine
my avatare ok ill just say youll hate him wgen you find him
0 0
kyle adenjohn05
02/20/2017 2:28 AM
Village (Plague)
hi guys
3 0
NIGHTMARE NIGHTMARRSHOP
02/19/2017 8:15 PM
Vuelo Glacial
me encanta volar
1 0
NIGHTMARE NIGHTMARRSHOP
02/19/2017 8:10 PM
Máquina Voladora
es increible caer en un hoyo despues de vencer a popeller knight, es muy cool
0 0
Nash betonash
02/19/2017 6:17 PM
Explotatorium
5 1
Nash betonash
02/19/2017 6:14 PM
Explotatorium
3 0
Nash betonash
02/19/2017 5:51 PM
Fortaleza del Orgullo
2 0
luigi isaiah1b
02/19/2017 5:37 PM
Clockwork Tower
soo easy first try your robots a dowp bot lol
3 0
luigi isaiah1b
02/19/2017 5:26 PM
Clockwork Tower
1 0
Brayden Brehder5
02/19/2017 5:13 PM
Plains
Hi my name is Jeff snd i am a potatoe
3 0
GRUMP GUY Sans4000
02/19/2017 4:53 PM
Iron Whale
its me BEEEEEENIS that be me amiibos name
3 0
Sope sci24680
02/19/2017 4:32 PM
Iron Whale
Defeated Twesha Knight, let's go XO
1 0
Endymion Endymion_Osiris
02/19/2017 3:35 PM
Explodatorium
that was hard
0 0
Endymion Endymion_Osiris
02/19/2017 3:18 PM
Explodatorium
he is so hard
0 0
luigi isaiah1b
02/19/2017 1:58 PM
Explodatorium
first try lol
0 0
luigi isaiah1b
02/19/2017 1:23 PM
Iron Whale
were goin on a trip on are least faveret ship
1 0
luigi isaiah1b
02/19/2017 1:13 PM
Iron Whale
1 0
luigi isaiah1b
02/19/2017 12:48 PM
Explodatorium
dont worry in the fucher there will be robot ones lol no literly there are
0 0
Jared SKYLORDARMY
02/19/2017 12:36 PM
Tower of Fate: Entrance
0 0
spyke doggysrock
02/19/2017 12:20 PM
The Lich Yard
helpppppppp
1 0
luigi isaiah1b
02/19/2017 12:00 PM
Pridemoor Keep
so much mice . explodijg mice plafu night. flyying mice almost evertwere. and robot mice i forget
1 0
luigi isaiah1b
02/19/2017 11:58 AM
Pridemoor Keep
who will beat game without gear or iteam
0 0
luigi isaiah1b
02/19/2017 11:49 AM
Plains
i use to beat all no qourters till a glithc hapend :c
0 0
payton jr. gungamer123
02/19/2017 11:35 AM
Village
i got max magic points and health :)
4 0
chuchundra skylandersdjosue
02/19/2017 11:10 AM
Villa
EL MEJOR MINIJUEGO DEL MUNDO!!!
0 0
luigi isaiah1b
02/19/2017 9:13 AM
Stranded Ship
holly cow my guy is doing victory pose on spikes
0 0
luigi isaiah1b
02/19/2017 9:00 AM
Stranded Ship
so agre this area is so hard
1 0
PIERSON miketaylr
02/19/2017 8:24 AM
Plains
0 0
Lee MrBrake
02/19/2017 6:56 AM
Troupple Pond
0 0
luigi isaiah1b
02/19/2017 5:43 AM
Explodatorium
the thing that makes guys unable to hit helps till u run out of majik i did it and won
0 0
luigi isaiah1b
02/19/2017 5:39 AM
Explodatorium
i hate him he spayses you out he spams booombs and he has so much bomb just o my gosh
3 0
dizz dizzkids
02/19/2017 5:32 AM
Plains
3 0
Spaceneko Nekosinspac3
02/18/2017 6:50 PM
Pridemoor Keep
omg cannot kill king knight
1 0
Alex! alex-bubby
02/18/2017 6:17 PM
Plains (Plague)
watch out for my fearce cane!!
8 0
chuchundra skylandersdjosue
02/18/2017 6:08 PM
Torre del Hado: ???? (Plague)
Solo mori una vez
1 1
Alex! alex-bubby
02/18/2017 5:55 PM
Tower of Fate: ???? (Plague)
if you dont move he kills himself
5 0
Alex! alex-bubby
02/18/2017 5:47 PM
Tower of Fate: ???? (Plague)
gulp shure is gloomy in here
2 0
Alex! alex-bubby
02/18/2017 5:45 PM
Tower of Fate: Ascent (Plague)
that trator shovel knight
0 0
Alex! alex-bubby
02/18/2017 5:40 PM
Tower of Fate: Ascent (Plague)
im out of bombs time to use my staff
1 0
Brandon shovelknight9999
02/18/2017 3:24 PM
Clockwork Tower
use the moving gear on the first part of the boss fight. It does an instant k.o.
0 0
Rene rene5263
02/18/2017 1:33 PM
Explodatorium
1 0
Brooklyn brookiegaming
02/18/2017 1:10 PM
The Lich Yard
Best game ever! But so hard!
0 0
Mason Base.Cottam
02/18/2017 12:14 PM
Plains
lol im going for the ''impossible'' achievment. only beat one boss though
0 0
Chara 4souls64
02/18/2017 12:11 PM
Flying Machine
so hard
1 0
Alex! alex-bubby
02/18/2017 11:32 AM
Clockwork Tower (Plague)
IMA CRUSH HIM WITH VATS
0 0
Alex! alex-bubby
02/18/2017 11:30 AM
Clockwork Tower (Plague)
EASY
1 0
Mat2 MatII3503
02/18/2017 11:16 AM
Explodatorium
2 0
jurr CLCV02
02/18/2017 10:46 AM
Pridemoor Keep
so hard
0 0
Gold fredbear2003
02/18/2017 9:58 AM
Iron Whale
this game is dope
0 1
Liam Nucliam
02/18/2017 9:32 AM
Plains
Ehhhh
2 0
gavin Gavo2009
02/18/2017 8:37 AM
Plains
0 0
aturisk pavdad
02/18/2017 7:19 AM
Plains
pe for lie
0 0
jack Wolfbane3
02/18/2017 7:17 AM
Village
Hail the Troupple king!
5 0
Wallrun liambp
02/18/2017 6:20 AM
Explodatorium
2 0
samandalex cowboyfans16
02/18/2017 5:24 AM
Lost City
this is not the walk in lava i expected
2 0
Alex! alex-bubby
02/17/2017 10:07 PM
Tower of Fate: ???? (Plague)
easy so easy final boss=easy
0 0
soleorpheu soleorpheuse812
02/17/2017 9:51 PM
Troupple Pond
grgfjggjfdrndcdfdfdddbf
1 0
Alex! alex-bubby
02/17/2017 9:45 PM
Tower of Fate: Ascent (Plague)
big boom destroys shovle knight
1 0
jurr CLCV02
02/17/2017 8:58 PM
The Lich Yard
so hard
11 0
soleorpheu soleorpheuse812
02/17/2017 8:55 PM
Troupple Pond
0 0
Alex! alex-bubby
02/17/2017 8:53 PM
Encounter - Phantom Striker (Plague)
i defeted them all this phantom guy was the same HA
0 0
Payton BlueMLink
02/17/2017 8:43 PM
Plains
great game!
3 0
Brandon shovelknight9999
02/17/2017 8:38 PM
Lost City (Plague)
cluster powder is extremly helpful, find spots to strike
0 0
Cake MagicGuy
02/17/2017 6:51 PM
Pridemoor Keep
There's a secret here. Just letting you know.
2 1
nickt limitlessmight25
02/17/2017 6:24 PM
Pridemoor Keep
definitely hard
3 3
James Hockeyjam
02/17/2017 5:37 PM
Pridemoor Keep
The shandaliers fall on ypu cause ur too ugly
4 0
Alex! alex-bubby
02/17/2017 5:30 PM
Plains (Plague)
a cheat makes you a god and i can now ACEND
1 0
lucas redfox1031
02/17/2017 4:58 PM
Explodatorium
0 0
lucas redfox1031
02/17/2017 4:55 PM
Explodatorium
0 0
Brandon shovelknight9999
02/17/2017 3:36 PM
Flying Machine (Plague)
beserkers brew is extremly helpfull use it to you advantage
1 0
Keats Keats16
02/17/2017 3:00 PM
Plains
I will rule the world it will all be black
1 0
SonicFan21 zeldalink22
02/17/2017 2:46 PM
Encounter - Baz
Just Defeated Baz Such A sore Loser
3 0
rick CJ2608
02/17/2017 2:12 PM
Plains
me and my friend as just meat a level
1 0
luna luna Junon42
02/17/2017 2:10 PM
Knuckler's Quarry
how do i dash
3 0
ejgalvez ejultra
02/17/2017 1:36 PM
Stranded Ship
lel
3 0
Garrett Garrett710283
02/17/2017 1:31 PM
The Lich Yard
this phantom level is killing me! literaly
2 0
Ed ednortonjr
02/17/2017 12:01 PM
Troupple Pond
0 0
Joshua DarkKnightBVB11
02/17/2017 10:11 AM
The Lich Yard
Talk to the SHOVEL cause the face ain't LISTING!
4 0
Thightus Thigtus
02/16/2017 8:56 PM
Plains
hell yeh
0 0
Lane OG_GIGAWOLF
02/16/2017 8:15 PM
Village
this game is sooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo hard!!
1 0
Toonlink77 childers04
02/16/2017 6:05 PM
Forest of Fishing (Plague)
Hee Hee This is easy for me
1 0
Ninja Boy 042568
02/16/2017 1:58 PM
Lost City
This game is amazing!
2 0
zpark ramirez10
02/16/2017 12:09 PM
Torre del Hado: Entrada
jjajajajaja nadie puede conmigo!
0 0
omegadot omegadot
02/16/2017 9:48 AM
Plains
0 0
Nash betonash
02/16/2017 4:42 AM
Fortaleza del Orgullo
0 0
omegadot omegadot
02/16/2017 4:35 AM
Plains
2 0
maxxaxfgeh maxbyer
02/15/2017 10:38 PM
Plains
3 0
Four eyes Blastbox22
02/15/2017 7:15 PM
Encounter - Baz
He's vulnurable to being Shovel Bounced, but beware; The Baz is a literal lighting-quick adversary!
0 0
Four eyes Blastbox22
02/15/2017 6:26 PM
Explodatorium
Even these slimy mockeries know their bit of Shovelry! Watch your head!
3 0
Four eyes Blastbox22
02/15/2017 6:20 PM
Explodatorium
The vials he throws are similar to Mona's, wouldn't you say?
3 0
AURHEN xPl4guEx
02/15/2017 6:18 PM
Tower of Fate: Ascent
0 0
Four eyes Blastbox22
02/15/2017 6:16 PM
Explodatorium
The floors here are as volatile as the chemicals! Be careful where you Shovel Bounce!
4 0
Four eyes Blastbox22
02/15/2017 6:14 PM
Explodatorium
Rumor says Plague Knight hides a relic in this room, behind a wall...
4 0
James Hockeyjam
02/15/2017 6:05 PM
Plains
why the boss
5 0
FRG44 FRGUIDO
02/15/2017 5:05 PM
Plains
kkk
1 0
Jack KilgoreX
02/15/2017 4:33 PM
Plains (Plague)
how to get pact the blocks above you?
1 0
Alexey PapiBoyZay3412
02/15/2017 3:33 PM
Plains
jffi
1 0
steveo134 steveo134
02/15/2017 12:35 PM
Stranded Ship
the polar knight...any tips?
2 0
jonny jsmooth07
02/15/2017 10:53 AM
The Lich Yard
great game
1 0
Robert pizzza4ever
02/15/2017 3:26 AM
The Lich Yard (Plague)
ITS THE HEADLESS SWORDSMAN
0 0
Robert pizzza4ever
02/15/2017 3:25 AM
The Lich Yard (Plague)
OH MY GOD, ANOTHER PAPYRUS!!!
0 0
Robert pizzza4ever
02/15/2017 3:25 AM
The Lich Yard (Plague)
ITS PAPYRUS!!
0 0
Robert pizzza4ever
02/15/2017 3:23 AM
The Lich Yard (Plague)
Hello everyone, my name is Denzel Crocker, and I must find this knight's FAIRY GOD PARENTS!!
0 0
Robert pizzza4ever
02/15/2017 3:14 AM
Pridemoor Keep (Plague)
I need your soul! EAT BOMBS FIEND!!
0 0
Robert pizzza4ever
02/15/2017 3:13 AM
Pridemoor Keep (Plague)
LLLLLLETS GET READY TO RUMBLLLLLLLLLLLLLLLLLLLLLLLLE!!!
0 0
Robert pizzza4ever
02/15/2017 3:11 AM
Pridemoor Keep (Plague)
YES I DID IT!! NYEH HE HEH!!
0 0
Flo UltraFlo
02/14/2017 9:22 PM
Torre del Hado: ???? (Plague)
Dificil
1 0
Jason jlovin
02/14/2017 7:29 PM
Pridemoor Keep
take that fake king
0 0
alexplayZ Alexander0325
02/14/2017 6:36 PM
Pridemoor Keep
King Knight, you shall go down in history!
3 1
Reagan Randahl306
02/14/2017 6:09 PM
Village
This village has a magic shop!!
5 0
Robert pizzza4ever
02/14/2017 5:52 PM
Pridemoor Keep (Plague)
is amazing as plauge knight, died 20 times to baz as shovel knight
0 0
dawson monkey1885
02/14/2017 5:07 PM
Plains
1 0
Thomas GameCricket
02/14/2017 4:18 PM
Plains
Praise the sun!
1 0
Matthew swbro915
02/14/2017 4:14 PM
The Lich Yard
2 0
Liam Nucliam
02/14/2017 4:06 PM
Lost City
Why did Treasure Knight steal the ocean? He was feeling blue!
6 0
Four eyes Blastbox22
02/14/2017 3:12 PM
Pridemoor Keep
Beware of his fanfare and confetti! It may be ridiculous, but it's dangerous paired with his speed!
1 0
Four eyes Blastbox22
02/14/2017 3:02 PM
Pridemoor Keep
Treasure can hide in any nook and cranny; even behind those red banners!
1 0
Four eyes Blastbox22
02/14/2017 3:01 PM
Pridemoor Keep
You can cancel a Shovel Bounce by attacking! Make sure you don't get too eager with it here!
1 0
Kentaro Dfan236
02/14/2017 2:27 PM
Village (Plague)
hey you! watch me dance!
8 0
DB90X DragonBlasterX
02/14/2017 1:05 PM
Plains
0 0
Omega Obsidianleaf
02/14/2017 9:26 AM
Village
Where can I find the jester who sells the Propeller Dagger in Propeller Knight's stage?
2 0
leah pinkkitten42
02/13/2017 5:02 PM
Plains
hello all!
1 0
Bill zombiemoose
02/13/2017 3:08 PM
The Lich Yard
i won!!!!!
0 0
Jack KilgoreX
02/13/2017 2:43 PM
The Lich Yard
4 0
Jack KilgoreX
02/13/2017 2:18 PM
The Lich Yard
why spectre knight????!!!!!!!
3 0
Jack KilgoreX
02/13/2017 2:14 PM
The Lich Yard
spectre knight is impossible!!! how do i kill him?
1 0
Tempest Tempestryke
02/13/2017 1:25 PM
Stranded Ship
Ooh this place is pretty.
1 0
Lynda Shadymama
02/13/2017 8:57 AM
Plains
1 0
Jeremy Stealthhhunter18
02/12/2017 6:50 PM
Pridemoor Keep
Scout Knight: Be wary sir. . . The Propeller Rats are our most fearsome foe!
1 0
Zach profzachattack
02/12/2017 6:09 PM
Forest of Phasing
I always die in the most stupid ways
3 0
#BT bendy danielischeese
02/12/2017 5:47 PM
Lost City
help
1 1
Ito Marioandboo
02/12/2017 5:42 PM
Forest of Phasing
i just want to play
3 0
Yael a170902
02/12/2017 2:47 PM
Campiña
Genial!
9 0
MuttaMan MuttaMan
02/12/2017 2:35 PM
The Lich Yard
DAMIEN
2 0
Cesar AnGorDeV
02/12/2017 2:21 PM
Fortaleza del Orgullo
0 0
Cesar AnGorDeV
02/12/2017 1:52 PM
Fortaleza del Orgullo
0 0
Cesar AnGorDeV
02/12/2017 1:31 PM
Villa
1 0
Cesar AnGorDeV
02/12/2017 1:28 PM
Villa
2 0
Frisk toshaplus3
02/12/2017 1:05 PM
Flying Machine (Plague)
use orbiting, long fuse, cluster and vat.
0 0
ShyBiscuit biscuitdog24
02/12/2017 12:37 PM
Village
kid therey: why does shovel night not reveal his face?
3 5
luisale giovaz84
02/12/2017 12:30 PM
Finca de Liches
esquibarlo
0 0
luisale giovaz84
02/12/2017 12:27 PM
Finca de Liches
casi derroto a specter knic
0 0
luisale giovaz84
02/12/2017 12:23 PM
Finca de Liches
esmuy fuerte
0 0
WAT?!? justinq33
02/12/2017 12:16 PM
The Lich Yard
Finally Ahh!
0 0
Hayden97 haydengold97
02/12/2017 12:08 PM
Alternating Arsenal
Bee Movie x Street Fighter x Samuel L Jackson
0 0
WAT?!? justinq33
02/12/2017 12:06 PM
The Lich Yard
SPECTER KNIGHT IS LITTERALY IMPOSSIBLE!
4 0
nathan2 KiwiBird39
02/12/2017 11:57 AM
Explodatorium
1 0
Ben coatsmanthegamer
02/12/2017 11:12 AM
Plains
this is my friends first time playing
0 0
Hayden97 haydengold97
02/12/2017 10:16 AM
Village
2 0
Axel KissMineAxe
02/12/2017 8:12 AM
Tower of Fate: Ascent (Plague)
1 0
Axel KissMineAxe
02/12/2017 7:51 AM
Tower of Fate: Ascent (Plague)
I am way to mad right now
1 0
Four eyes Blastbox22
02/11/2017 10:50 PM
Pridemoor Keep
Don't forget, you can reflect projectiles with proper timing!
0 0
Andrew1234 madbusta
02/11/2017 8:20 PM
Village (Plague)
plauge of shadows
4 0
Custroy chatterdude
02/11/2017 8:01 PM
Tower of Fate: ???? (Plague)
And I still can't dance...
1 0
dominick dominick2409
02/11/2017 7:52 PM
Finca de Liches
al fin mate a spectre
1 0
Minta♪ minta27
02/11/2017 5:58 PM
Pridemoor Keep
1 0
LuigiGeek LuigiGeek347
02/11/2017 5:36 PM
Village
12 1
jaffed jaffed777
02/11/2017 4:45 PM
Fortaleza del Orgullo
no aguanto mas me estoy bolbiendo loco
2 0
jaffed jaffed777
02/11/2017 4:42 PM
Fortaleza del Orgullo
lo que bueno este jueguo
3 0
Wallrun liambp
02/11/2017 3:17 PM
Village
Lovin this game. Just got it and lovin it all
1 0
Zander RedFez11
02/11/2017 3:14 PM
Hall of Champions
HEY I'M GRUMP
3 0
Louis ank21689
02/11/2017 2:30 PM
Plains
to easy
1 0
jame HunterRock2015
02/11/2017 2:10 PM
Clockwork Tower
he look friendly at first but after you beat him the first time you will see what i'm talking about!
4 0
dominick dominick2409
02/11/2017 1:47 PM
Campiña
primer jefe derrotado
1 0
dominick dominick2409
02/11/2017 1:43 PM
Campiña
tonto esqueleto
3 0
joshwa joshwa2013
02/11/2017 12:31 PM
Plains
2 0
whale DebHamilton
02/11/2017 11:40 AM
Plains
my game is gliched
1 0
whale DebHamilton
02/11/2017 11:34 AM
Plains
2 0
whale DebHamilton
02/11/2017 11:32 AM
Plains
same here
1 0
Toasty bananamctoast
02/11/2017 11:32 AM
Plains
Ive got god mode
0 0
Mr.J Mr.Squeakums7331
02/11/2017 11:27 AM
Village (Plague)
Let your legs dance and your potions be your metranome
1 0
whale DebHamilton
02/11/2017 11:23 AM
Plains
sup i luv this game if you do 2 theirn say melon
1 0
Etinev ethanevan1972
02/11/2017 10:46 AM
Stranded Ship
I can barf rainbows now!!!
2 0
Mr.J Mr.Squeakums7331
02/11/2017 10:28 AM
Explodatorium (Plague)
So Much Of The Challenge
2 0
baz irule44
02/11/2017 10:27 AM
Pridemoor Keep
vhchMCVCGTIKDBHB
2 0
Mike micmacjeph
02/11/2017 10:19 AM
Iron Whale
I don't like the big treasure fish section
0 0
martin SlashMoonRock
02/11/2017 9:39 AM
Tower of Fate: ????
2 0
Dane Dragonbeem
02/11/2017 9:18 AM
Explodatorium (Plague)
messed up my chance ror a feat...
1 0
Trey TMman1
02/11/2017 9:12 AM
Tower of Fate: Ascent
Even on New Game + it's too easy, bro.
1 0
brayden rocket5454
02/11/2017 9:08 AM
Flying Machine
I've died 20 times already
1 0
Bruno MB-Fdez
02/11/2017 8:57 AM
Campiña (Plague)
3 0
martin SlashMoonRock
02/11/2017 8:54 AM
Plains
1 0
doc redhairedluigi
02/11/2017 8:38 AM
The Lich Yard
cant get past speter knight so hard
3 0
David dgaliata
02/11/2017 8:20 AM
Flying Machine
0 0
James jvgruber
02/11/2017 5:03 AM
Tower of Fate: Ascent (Plague)
I wonder what tge potion of uktimate power does?
2 0
Zack5157 zack541235855688
02/11/2017 4:10 AM
Plains
Boss Is Defeated
0 0
Matt mbeisswenger
02/11/2017 3:51 AM
Clockwork Tower
hoi
1 0
cdnm:marie derpysqid
02/10/2017 8:50 PM
Plains
yaay, first entry!!!
4 0
Alex AlexNura07
02/10/2017 7:59 PM
Finca de Liches
boy por ti biejo amigo
2 0
Four eyes Blastbox22
02/10/2017 5:02 PM
The Lich Yard
Don't move around too much when the scythe's flying, and time your jump when he closes in!
2 0
zero S1NU3N4T4N43L
02/10/2017 5:00 PM
Campiña
hey
3 0
Four eyes Blastbox22
02/10/2017 4:43 PM
The Lich Yard
Those skeleton heads count as weight too! Watch out!
5 0
Connor Connor1238
02/10/2017 4:37 PM
Plains
how to beat first boss
2 1
Four eyes Blastbox22
02/10/2017 4:12 PM
Plains
Word to the wise: You can reflect Black Knight's magic shots!
0 0
MasterJedi JediMaster-Lvl35
02/10/2017 12:56 PM
Plains
Whats up, yall?
1 0
tad sonic4eveh
02/10/2017 11:31 AM
Clockwork Tower
why dos this remind me of kirby music
1 0
tad sonic4eveh
02/10/2017 11:24 AM
Stranded Ship
nooooooooooo I fell.
1 0
noah Castleking1234
02/10/2017 8:16 AM
The Lich Yard
poop
2 0
Tuna poiuytrewmjvsxh7
02/10/2017 7:49 AM
Plains
It's Over 9000!
3 0
Dani leonja02
02/10/2017 6:48 AM
Campiña
yeah
3 1
Dani leonja02
02/10/2017 6:40 AM
Campiña
juego malo
0 0
jame HunterRock2015
02/09/2017 11:46 PM
Clockwork Tower
now i'm thinking dark kight is good but being control! don't you think?
3 0
jame HunterRock2015
02/09/2017 11:43 PM
Encounter - Phantom Striker
hi
0 0
jame HunterRock2015
02/09/2017 11:43 PM
Encounter - Phantom Striker
THE PHANTON STRIKER KILL ME BUT I KILL HIM AT THE SAME TIME BUT I'M STILL LIVING!!!!
1 0
Gavin gavinflac
02/09/2017 6:26 PM
Stranded Ship
0 0
Jonathan shadowd3781
02/09/2017 6:07 PM
Village
3 0
nicholas zhokep
02/09/2017 3:36 PM
Iron Whale
under the sea
2 0
Yui-chan Fortenium
02/09/2017 3:28 PM
Tower of Fate: Ascent
First attempt, I won!
0 0
Skylander PyroFox5
02/09/2017 12:18 PM
The Lich Yard
This was hard
0 0
daniel daniel_shalimov
02/09/2017 9:21 AM
Iron Whale
Who thinks specter knight is awsome?
6 0
NIGHTMARE NIGHTMARRSHOP
02/09/2017 8:38 AM
Charca Truchanzana (Plague)
bueno solo necesito la dorada para ir mas molon con plague knigh
0 0
NIGHTMARE NIGHTMARRSHOP
02/09/2017 8:37 AM
Charca Truchanzana (Plague)
a penas me entere de como conseguir las armaduras y no las necesito lo peor de todo
3 0
gummy me64 CyclonicDuke
02/08/2017 4:40 PM
Tower of Fate: Ascent (Plague)
cluster powter is over powerd
1 0
Keaton KJSAho
02/08/2017 3:09 PM
The Lich Yard
Rgk
3 0
Keaton KJSAho
02/08/2017 3:07 PM
The Lich Yard
1 0
yudha p. azarex136
02/08/2017 3:03 PM
Pridemoor Keep
it's morph(eat)in time
1 0
Nolan Nolster13
02/08/2017 2:04 PM
Pridemoor Keep
gg easy
0 0
benjamin Benja_sans
02/08/2017 8:30 AM
Finca de Liches
como mato a specter knight si solo tengo 4 vida
1 0
Logan GrandsonMiner
02/08/2017 7:46 AM
Pridemoor Keep
0 0
Gavin gavinflac
02/08/2017 5:18 AM
Explodatorium
i finally beat treasure knight
2 0
Dubbya dubbya1986
02/07/2017 9:20 PM
Pridemoor Keep
2 1
pull pullarfamily
02/07/2017 7:16 PM
Plains
0 0
pull pullarfamily
02/07/2017 7:16 PM
Plains
0 0
pull pullarfamily
02/07/2017 7:14 PM
Plains
oh hi guys
0 0
pull pullarfamily
02/07/2017 7:14 PM
Plains
can you guys say bad words?
2 0
pull pullarfamily
02/07/2017 7:13 PM
Plains
do you guys know a zadden he grabs his nutsevery dy he is a weirdo
0 0
pull pullarfamily
02/07/2017 7:11 PM
Plains
hey guys
0 0
pull pullarfamily
02/07/2017 7:10 PM
Plains
this s awsome i love christmas but by the way do you guys watch alex,denis,sub,corl there so cool
0 0
MartinMG martinsebastian4
02/07/2017 6:22 PM
Tower of Fate: Entrance
First to write here haha!!!
2 0
Toonlink77 childers04
02/07/2017 6:18 PM
Village (Plague)
Hee Hee Do you all like my lair Hee Hee BOOM!
3 0
Toonlink77 childers04
02/07/2017 6:07 PM
Plains (Plague)
2 0
Toonlink77 childers04
02/07/2017 6:05 PM
Plains (Plague)
Hee Hee The ending is adorable just wait till you see it BOOM!
1 0
xXSoren Eli_Shane15
02/07/2017 4:40 PM
Nave Varada (Plague)
Putos pinchos D:
0 0
lucas redfox1031
02/07/2017 4:40 PM
The Lich Yard
why did I not buy this game earlier?!
1 0
danny yokaiman25
02/07/2017 2:56 PM
Explodatorium
i hate both plague knights
1 0
Sam SonicSam06
02/07/2017 2:28 PM
Plains
1 0
Zach Zumakalif
02/06/2017 8:52 PM
Lost City
1 0
ian Legofan456321
02/06/2017 7:55 PM
Plains
hey guys
0 0
Matt MattNJack
02/06/2017 5:40 PM
Flying Machine
Y WONT HE DIE?!?!
0 0
Nevada Ronnielights
02/06/2017 2:43 PM
Village (Plague)
finally the final boss
1 0
jax spyrosc
02/06/2017 1:48 PM
Stranded Ship
CAN'T WAIT TILL SPECTOR OF TORMENT! YAHOO!
4 0
Favio Davi nees08
02/06/2017 1:48 PM
Villa
Derrote Black knigth
2 0
Matt MattNJack
02/06/2017 6:33 AM
Flying Machine
I FOUND FISH HEAD!!!!!!
0 0
Matt MattNJack
02/06/2017 6:31 AM
Clockwork Tower
people may think im lying but seriously i beat plague knight on second try!
0 0
Andres ornstein97
02/05/2017 10:07 PM
Rematch: The Big Creep
0 0
xXSoren Eli_Shane15
02/05/2017 6:40 PM
Máquina Voladora
Estuvo buena la pelea :D
0 0
doc redhairedluigi
02/05/2017 5:11 PM
The Lich Yard
3 0
danny yokaiman25
02/05/2017 4:59 PM
The Lich Yard
i hate specter knight!!!!!
2 0
danny yokaiman25
02/05/2017 4:51 PM
The Lich Yard
i am never going to beat specter knight
2 0
tron Willis123458
02/05/2017 3:40 PM
Plains
me too
0 0
xXSoren Eli_Shane15
02/05/2017 3:23 PM
La Ciudad Perdida
No puedo conseguir la partitura D:
1 0
xXSoren Eli_Shane15
02/05/2017 2:52 PM
Explotatorium
Plague Knight estabas bien facil xd
0 0
Kimball black4mom
02/05/2017 2:47 PM
Armor Outpost (Plague)
how do you get into armor outpost on plague knight
1 1
xXSoren Eli_Shane15
02/05/2017 2:22 PM
Encuentro - Baz
Diste lo mejor de ti Baz
1 0
Travis TRAVIS0825
02/05/2017 12:18 PM
Village
My favorite character in this game is Luigi. I like how he can suck people up. Splatoon is AWESOME!!
6 0
joe jdrago
02/05/2017 10:53 AM
Plains (Plague)
omg 1 boss
1 0
Gabe Gabestack
02/05/2017 10:25 AM
Plains
HELLO! WELCOME TO ANOTHER INFINIDAGGER ADVENTURE
5 0
Justin epicsause21
02/05/2017 8:18 AM
Plains
I am playing as buttbutt
3 0
NOAH nrangno
02/05/2017 7:58 AM
Plains
1 0
luvp3ts06 MeCute06
02/05/2017 7:47 AM
Village
3 0
chris aftondes
02/05/2017 6:51 AM
The Lich Yard
noooooooo
1 0
MVP!! IMAKEPUNS
02/04/2017 10:41 PM
Iron Whale
found Unit01 version of custom knight
0 0
Daniel Daniel8273
02/04/2017 9:32 PM
Torre del Hado: Ascensión
todos los jefes es tan bien difíciles :(
2 0
jaden chingfamily
02/04/2017 8:54 PM
The Lich Yard (Plague)
good job breh famlit
0 0
jaden chingfamily
02/04/2017 8:45 PM
Village (Plague)
yes behind the big orlong
0 0
jaden chingfamily
02/04/2017 8:44 PM
Village (Plague)
no
0 0
jaden chingfamily
02/04/2017 8:42 PM
Village (Plague)
no
0 0
makiko Makiko-the-great
02/04/2017 7:49 PM
The Lich Yard
This is awesome!
0 0
PAINKEEL PAINKEEL
02/04/2017 6:36 PM
Armor Outpost
im so sad i got the skill for my shovel that you need 3000 gold and i idk how to use it yet any help
2 1
Bannon BannonT
02/04/2017 4:01 PM
Plains
in me mums carrrr!!!!
0 0
cody ponyo808
02/04/2017 3:45 PM
Plains
i just deafeted the blach night
3 0
cody ponyo808
02/04/2017 3:38 PM
Plains
0 0
gummy me64 CyclonicDuke
02/04/2017 3:35 PM
Armor Outpost (Plague)
4 0
cody ponyo808
02/04/2017 3:34 PM
Plains
OMG The black knight is hard
0 0
Frosty excharles
02/04/2017 3:02 PM
Village
jogo bom, queria que fosse maior
2 1
Ethan EthanSamK
02/04/2017 2:44 PM
Plains
Play with my younger brother. =)
1 0
Drabones mariokartprince
02/04/2017 2:02 PM
Iron Whale
Replaying Shovel Knight with co-op. Its really good
0 0
Osiris Osiris-Drax
02/04/2017 1:45 PM
Plains
just jump on the black knight. first time through was easy enough
0 0
Dii Johangir
02/04/2017 1:02 PM
Flying Machine
hey, you made it! keep it a secret
0 0
Joe JoseyWales89
02/04/2017 1:00 PM
Plains
How do i beat the first boss?
0 0
Dii Johangir
02/04/2017 12:44 PM
Hall of Champions
take that, kickstarter backers
0 0
Dii Johangir
02/04/2017 12:38 PM
Hall of Champions
definitely not a trap
1 0
Luiz Luiz4949
02/04/2017 12:28 PM
Plains
black butt defeated
0 0
Ian white_hound
02/04/2017 10:55 AM
Pridemoor Keep
Time ti face king knight in new game plus
3 0
MartinMG martinsebastian4
02/04/2017 8:28 AM
Encounter - Baz (Plague)
be...at.. A ...baz!
0 0
MartinMG martinsebastian4
02/04/2017 8:19 AM
Village (Plague)
sure i want to post it in miiverse....
2 0
MartinMG martinsebastian4
02/04/2017 8:13 AM
Troupple Pond (Plague)
Yes! i met pewdiepie...... wait no! it was trouple king!!
1 0
MartinMG martinsebastian4
02/04/2017 8:07 AM
Encounter - Reize (Plague)
yey...
0 0
kasper Starlord9x9
02/04/2017 8:05 AM
Stranded Ship
POLAR KNIGHT!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
1 0
MartinMG martinsebastian4
02/04/2017 7:54 AM
Armor Outpost (Plague)
yeah boi........ d...id it!
0 0
MartinMG martinsebastian4
02/04/2017 7:39 AM
Iron Whale (Plague)
Oh... go..od.. 4 me... yay...
0 0
Dani dannyddayz
02/04/2017 7:37 AM
Plains
0 0
EMAssassin rawlingslab42
02/04/2017 7:26 AM
Village
I hope you all know... I visit this village in the dead of night. Be afraid... of the Specter...
3 1
Fershoo CRISRAMGR
02/04/2017 7:13 AM
Campiña
3 0
Mr Patas reyhayabusa
02/04/2017 6:06 AM
Campiña
hola
5 1
CoolBro 64 adamstladcfvvdcy
02/04/2017 5:55 AM
Plains
Hi's
1 0
Dev AveRak120
02/04/2017 5:30 AM
Plains
0 0
RyRy Babaganoosh2006
02/03/2017 9:29 PM
Encounter - The Lich Yard
ummm
0 0
Custroy chatterdude
02/03/2017 8:08 PM
Encounter - Black Knight (Plague)
Yes! Not damaged!
0 0
Custroy chatterdude
02/03/2017 7:43 PM
Clockwork Tower (Plague)
I've been at the first checkpoint for about a hour already
1 0
logan theghostscloud
02/03/2017 6:53 PM
Stranded Ship
just beat polar knight. yessss!!!!!
2 0
Nintenkid temmieking
02/03/2017 4:39 PM
Plains
0 0
Ben benbro123
02/03/2017 3:33 PM
Plains
Hello first post
1 0
Stephen StephDaBouche
02/03/2017 2:43 PM
Armor Outpost
Mr Hat's a weird dude...
8 0
da_TEMMMMM haruto526659
02/03/2017 12:58 PM
Explodatorium
THIS LEVEL IS SO ANNOYING!!!!!!!!!
5 0
Sam chickenfans2
02/03/2017 9:51 AM
The Lich Yard
cool
0 0
Şkeletón Omninano
02/03/2017 9:19 AM
Explodatorium
Trying to beat him with no upgrades is the worst...
2 0
codif codiferis704
02/03/2017 9:13 AM
Pridemoor Keep
4 0
☆★καуιεε★☆ TheWorldIsKawaii
02/03/2017 5:21 AM
Plains
I really like this game! Really good! (˙˘˙)
1 0
EMAssassin rawlingslab42
02/02/2017 7:56 PM
Stranded Ship
The Chaos orb was the best tactic for me.
1 0
Eric eric377
02/02/2017 5:37 PM
Pridemoor Keep
2 0
shadow shadowtheheg3hog
02/02/2017 2:57 PM
Pridemoor Keep
can't wait for new update!
2 0
Liam ninjahippy64
02/02/2017 2:46 PM
Encounter - Baz (Plague)
HAHAHA!!! He's a cool dude... but the uniform isn't helping. Like, at all.
1 0
Eden Eden9903
02/02/2017 1:22 PM
Pridemoor Keep (Plague)
that was an uncomfortable fit...
5 0
Eden Eden9903
02/02/2017 8:40 AM
Village
who do you think would win? mario or shovel knight?
1 0
Eden Eden9903
02/02/2017 8:35 AM
Tower of Fate: Ascent
I beat them without drinking my ichor!
0 0
Dave Primetroidave
02/02/2017 7:09 AM
Village
I DONT WANT TO WATCH YOU DANCE, LADY!!!! Geez, broccoli head.
4 0
DSX kadleth
02/01/2017 8:57 PM
Village (Plague)
Wouldn't have believed that the Plague is even more fun than the Shovel
6 0
joshua joshuaseawolf
02/01/2017 5:51 PM
The Lich Yard (Plague)
oh no
0 0
gummy me64 CyclonicDuke
02/01/2017 5:27 PM
Plains (Plague)
2 0
DESTROYER Taha1980
02/01/2017 4:18 PM
The Lich Yard
0 0
Axel KissMineAxe
02/01/2017 4:03 PM
Lost City (Plague)
1 0
dex dexterhudson
02/01/2017 3:40 PM
Plains (Plague)
get monny! get mona!
0 0
doc redhairedluigi
02/01/2017 3:24 PM
The Lich Yard
hjoofhyfhhh hard
1 0
EdGe BoY skoogs
02/01/2017 11:53 AM
Stranded Ship
*insert headbanging sounds*
3 0
jake JacobHubb1983
02/01/2017 10:51 AM
Plains
just got an amiibo!
3 0
Joemoebob Hexalite
02/01/2017 10:49 AM
Troupple Pond
i farted on a squirrel
3 1
Jorge JorgeMendoza3008
02/01/2017 6:46 AM
Campiña
segundo gran juego que he comprado :D
1 0
Jacob Lightspeed7000
01/31/2017 9:12 PM
Clockwork Tower
AAAAAAH! It's so difficult but I love it so much!
0 0
Brandon shovelknight9999
01/31/2017 8:14 PM
Clockwork Tower
this reminds me of metal man's stage from megaman 2
4 0
dex dexterhudson
01/31/2017 5:49 PM
Village (Plague)
i see the cerulean cowerd now! #pussycat
2 0
dex dexterhudson
01/31/2017 5:44 PM
Village (Plague)
ha! ha! ha i say! that sllver chestnut is nothing more then a cowerd
6 0
dex dexterhudson
01/31/2017 5:15 PM
Plains (Plague)
endless luck to all! and a happy new year!
0 0
Dane Dragonbeem
01/31/2017 4:41 PM
Tower of Fate: Entrance
gimme more meal tickets
5 0
Valentin betogameza
01/31/2017 4:20 PM
La Ciudad Perdida
0 0
Aeneas ehseezee
01/31/2017 3:09 PM
The Lich Yard
got so close
0 0
William frigogin
01/31/2017 1:47 PM
Stranded Ship
2 0
Creeper050 creeperalex050
01/31/2017 11:56 AM
Stranded Ship
One day ice levels, you shall die!
2 0
emo kitty dantheman900000
01/31/2017 9:51 AM
Pridemoor Keep
fire staff it is so lit
1 0
Luis lace1991
01/31/2017 7:15 AM
Campiña
3 0
mark jhsmark
01/31/2017 4:56 AM
Plains
2 0
richard mintelon
01/31/2017 4:53 AM
Cantera Nudillos
ya casi me acabo el juego pero estoy en el penultimo nivel
2 0
Lubak Link96bak
01/30/2017 10:58 PM
Nave Varada
1 0
Stavesacre StavesacreFamily
01/30/2017 7:17 PM
Lost City
Oh no, i blew up my walkway!
0 0
Eden Eden9903
01/30/2017 4:42 PM
Frigid Flight
1 0
doc redhairedluigi
01/30/2017 4:19 PM
The Lich Yard
1 0
Axel KissMineAxe
01/30/2017 3:46 PM
The Lich Yard (Plague)
1 0
Axel KissMineAxe
01/30/2017 3:41 PM
The Lich Yard (Plague)
2 1
Neil Unreal_Neil
01/30/2017 3:38 PM
Village
4 1
Alex Kimheng253
01/30/2017 1:42 PM
Tower of Fate: Entrance
Psst there is no spoilers! haaaaaaaaaaaaaaaaaaaaaaaaa
5 0
Monapola qw3rte
01/30/2017 12:32 PM
Village
pridemoor keep in 4:23.15!
0 0
Monapola qw3rte
01/30/2017 12:23 PM
Plains
just completed 1st level in 3:49.62
0 0
dj thundergodj
01/30/2017 7:14 AM
Lost City
0 0
Elías banels
01/30/2017 5:35 AM
Villa
Amo este juego ♥
3 0
Ash☆ Murlocvash
01/30/2017 2:22 AM
Plains
1 0
Ash☆ Murlocvash
01/30/2017 1:41 AM
Flying Machine
12 0
Ash☆ Murlocvash
01/30/2017 1:09 AM
Flying Machine
3 0
lil wierdo videogameguy127
01/29/2017 4:46 PM
Plains
first time playing on wii u
2 0
kevza kevzapatab
01/29/2017 4:41 PM
Explodatorium
Man, I always beat the boss when I'm one or two hits away of being KO'ed
5 0
MiDxDragon MiDixDragon
01/29/2017 4:16 PM
Armor Outpost
i felt so happy when i killed this guy
4 0
karatekid¹ karatecoolkid
01/29/2017 2:53 PM
Lost City
0 0
karatekid¹ karatecoolkid
01/29/2017 2:40 PM
Iron Whale
this level is so hard
4 0
Parker roboparker
01/29/2017 1:48 PM
Stranded Ship (Plague)
cant use rainbow ice dragonn
2 0
Dane Dragonbeem
01/29/2017 1:37 PM
Flying Machine
yeeeeeeaaaaaahhhhhh dance :D
3 0
JBizzle! yodamaster516
01/29/2017 1:10 PM
Village
100 Magic capacity! Finally!
6 2
dad packsfan
01/29/2017 12:25 PM
Pridemoor Keep
0 0
Thomas sharkbait101804
01/29/2017 11:49 AM
Plains
0 0
Custroy chatterdude
01/29/2017 11:48 AM
Explodatorium (Plague)
Shovel Knight just defeated Plague knight after he was defeated
2 0
carlos TMTCarlos
01/29/2017 11:43 AM
Plains
i can't beat this boss
0 0
lukie LUUTacris86
01/29/2017 11:30 AM
Pridemoor Keep
everybody try the cheat code X&BUTT its "butt er" than other cheats
0 0
kobe kobejohnson
01/29/2017 11:21 AM
Flying Machine
ughhh apple peeeen
1 0
Ostrich JOHNSONFAM0023
01/29/2017 11:11 AM
Plains
hello children, come to my lair
1 0
Chris CWDDAVIS
01/29/2017 10:24 AM
Plains
How do you use the shovel knigh amiibo
0 0
timmy timobibi479
01/29/2017 9:46 AM
Tower of Fate: Entrance
OMG BLACK KNIGHT OP !!!
0 0
Greg Mariongreg123
01/29/2017 8:03 AM
The Lich Yard
0 0
Greg Mariongreg123
01/29/2017 7:24 AM
The Lich Yard
0 0
Greg Mariongreg123
01/29/2017 7:20 AM
The Lich Yard
ectyycyfcycyccctxt
1 0
joe ilikesonic21
01/29/2017 5:07 AM
Village
this game is hard!!
2 0
Billy billbrad
01/29/2017 4:32 AM
Stranded Ship (Plague)
i hate the hammer throwing gerbil things in this stage
0 0
Nikkon InhumanNikkon
01/28/2017 11:29 PM
Plains
bich is mine
0 0
Brandon shovelknight9999
01/28/2017 9:55 PM
Stranded Ship
my armours still blue
1 0
Sosaia Sosaia
01/28/2017 8:30 PM
Pridemoor Keep (Plague)
didnt find out bout update till now
2 0
Lil G ForeverCy
01/28/2017 6:47 PM
Tower of Fate: Ascent (Plague)
0 0
Ash☆ Murlocvash
01/28/2017 6:47 PM
Pridemoor Keep
4 0
Edvard ADDprinting
01/28/2017 6:40 PM
Plains
0 0
Lopo Farouter85
01/28/2017 6:09 PM
The Lich Yard
i got the amibo
0 0
AvengerD AvengerDalton
01/28/2017 5:24 PM
Plains
hello
2 0
jay Jaystarkiler2005
01/28/2017 5:01 PM
Explodatorium
2 0
dad westtx
01/28/2017 3:09 PM
Plains
coooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooleee
3 0
Brandon shovelknight9999
01/28/2017 1:41 PM
Tower of Fate: ???? (Plague)
final boss #3 is easy with culster and smoke bomb
1 0
Adam Kobra101
01/28/2017 1:40 PM
Troupple Pond
He dances... TOO MUCH!!!
1 1
Custroy chatterdude
01/28/2017 12:26 PM
Tower of Fate: ????
Shield Knight makes it so easy to defeat the final boss
5 0
Custroy chatterdude
01/28/2017 11:58 AM
Tower of Fate: Ascent
This is just too hard.
1 0
Jayman SansTehSkelePun
01/28/2017 11:54 AM
Plains
jeez black knight is hard
2 0
Mikey stevensonclan
01/28/2017 11:09 AM
The Lich Yard
I wasn't taking the level seriously until I died for the third time. Now I'm speedrunning
0 0
MartinMG martinsebastian4
01/28/2017 10:13 AM
Clockwork Tower
Yeah i..... b..eat boss...
1 0
Jameson jtimothy2003
01/28/2017 10:10 AM
Pridemoor Keep
1 0
Dane Dragonbeem
01/28/2017 10:10 AM
Explodatorium
plague stage puts traps in most annoying spots
3 0
Mesome713 iandizion713
01/28/2017 10:05 AM
Pridemoor Keep
3 0
DERPAZOID wizzel12345
01/28/2017 9:17 AM
Village
0 0
Gabo jogarome1985
01/28/2017 9:15 AM
Campiña
empezando una nueva aventura xD
1 0
Ant Lukeskywalker231
01/28/2017 8:20 AM
Plains
you all suck
3 0
Rune xRune92x
01/28/2017 8:02 AM
Village
wonderful game
0 0
Austin kra2008
01/28/2017 8:00 AM
Explodatorium
0 0
BiDaZzled BiDaZzled
01/28/2017 7:58 AM
The Lich Yard
how would you beat spectral knight?
3 0
Austin kra2008
01/28/2017 7:51 AM
The Lich Yard
0 0
ethan ethan112233
01/28/2017 6:58 AM
Pridemoor Keep
1 0
poppa bear Bear14CUB22
01/28/2017 6:48 AM
Iron Whale (Plague)
ez money
0 0
Austin kra2008
01/28/2017 6:21 AM
The Lich Yard
does my picture look nice
0 0
Austin kra2008
01/28/2017 6:20 AM
The Lich Yard
1 0
Austin kra2008
01/28/2017 6:10 AM
Village
i wish it was possible for everyone to be in the same game but it will not let us do that
3 0
Austin kra2008
01/28/2017 6:08 AM
Village
im almost done deafeating the specter knight
1 0
son msaunders88
01/27/2017 11:05 PM
Knuckler's Quarry
6 0
Treckey LuigiKoopa
01/27/2017 11:02 PM
Pridemoor Keep
0 0
Treckey LuigiKoopa
01/27/2017 10:46 PM
Plains
0 0
Baiatricio Patriciogonav
01/27/2017 8:20 PM
Fortaleza del Orgullo (Plague)
Im so hyped becausethe specter knight mode be soon
3 0
EMAssassin rawlingslab42
01/27/2017 7:02 PM
Lost City
Man, this music is beautiful. Captures the level, and just sounds great! Nice work, Yacht Club.
2 0
Josh joshuaparksemt
01/27/2017 6:23 PM
Plains
0 0
CoolBraden scotchy9008
01/27/2017 5:53 PM
Village
7.8/10 IGN too much water. JK! 9.7/10 IGN
0 0
Daddy formsubstance
01/27/2017 2:48 PM
Plains
i fat 10/10
0 0
Dane Dragonbeem
01/27/2017 2:43 PM
The Lich Yard
<-- how i feel when i go back to lichyard for the phase locket thing
0 0
Dane Dragonbeem
01/27/2017 2:37 PM
The Lich Yard
yeeeee
0 0
Dane Dragonbeem
01/27/2017 2:30 PM
The Lich Yard
who did turn out the lights they should meet the shovel blade
0 0
Dane Dragonbeem
01/27/2017 2:25 PM
The Lich Yard
specter is hard
2 0
Dane Dragonbeem
01/27/2017 2:24 PM
The Lich Yard
boo
1 0
Dane Dragonbeem
01/27/2017 2:18 PM
The Lich Yard
boo
1 0
Dane Dragonbeem
01/27/2017 1:51 PM
The Lich Yard
why specter knight
1 0
Dane Dragonbeem
01/27/2017 1:46 PM
The Lich Yard
how i feel about specter knight
0 0
Imswag688 SansSkeleton13
01/27/2017 12:54 PM
Troupple Pond
why does my life have to be like this
3 0
Luca Solaire25
01/27/2017 6:49 AM
Campiña
nice game!
1 0
Maddie Cookiedough7
01/27/2017 6:43 AM
Armor Outpost
Time to beat Mole knight! (I'm not even CLOSE to ready...)
4 1
Jonathan notophatsplease
01/26/2017 11:30 PM
The Lich Yard
0 0
Brady scouts1st
01/26/2017 6:18 PM
Tandem Travels
donger
4 0
MartinMG martinsebastian4
01/26/2017 4:38 PM
Forest of Fishing (Plague)
yeah... i... cl...eard.. the... r...o...om...
3 0
ole pappy linkdoeswii
01/26/2017 4:33 PM
Plains
did not injoy this part
2 0
MartinMG martinsebastian4
01/26/2017 4:24 PM
Pridemoor Keep (Plague)
furbeez
1 0
hunter herobrinehunterb
01/26/2017 4:08 PM
Village
4 0
hunter herobrinehunterb
01/26/2017 4:06 PM
Troupple Pond
met a apple fish
1 0
hunter herobrinehunterb
01/26/2017 3:28 PM
Plains
cant beat first boss
0 0
hunter herobrinehunterb
01/26/2017 3:21 PM
Plains
why can u jump in the black area where it shows gold
0 0
hunter herobrinehunterb
01/26/2017 3:20 PM
Plains
same here
1 0
hunter herobrinehunterb
01/26/2017 3:17 PM
Plains
1 0
hunter herobrinehunterb
01/26/2017 3:15 PM
Plains
who is shovel knight under da mask
0 0
hunter herobrinehunterb
01/26/2017 3:13 PM
Plains
thx
1 0
hunter herobrinehunterb
01/26/2017 3:12 PM
Plains
how u beat dragon
1 0
Sebastian carrillo2d
01/26/2017 2:20 PM
Campiña
jnkgjgdghshfoqgdsdddssw
0 0
MetalGamer MetalGamer3038
01/26/2017 1:55 PM
Campiña
muy muy original ♥
5 0
CWyatt333 crane9
01/26/2017 11:35 AM
Plains
AHHHHHH this boss fight! *~*
0 0
Gος†h∞ακηω Akanehibiki
01/25/2017 11:47 PM
Armor Outpost
mejor juego hasta ahorita de Eshop - best 8 bit game ever created !!! Reign quiero revancha
1 1
ethan wilclaw2
01/25/2017 6:30 PM
Tower of Fate: Entrance
0 0
David R dfreichert
01/25/2017 5:36 PM
Shivering Sprint (Plague)
1 0
bridger wils8187
01/25/2017 5:08 PM
Plains
black knite
1 0
bridger wils8187
01/25/2017 4:13 PM
Plains
0 0
Batman P-Dizzle311
01/25/2017 3:33 PM
Clockwork Tower
1 0
Jeremy MetalMach
01/25/2017 2:33 PM
Lost City
1 0
NIGHTMARE NIGHTMARRSHOP
01/25/2017 2:31 PM
Mansión de los Campeones
pague como $5000 para que mi recompensa sea de 50
1 0
Sergio sergiomister
01/25/2017 1:54 PM
Village
baaaaa
0 0
David dbtdwt
01/25/2017 5:55 AM
Stranded Ship
The phase locket helped a lot against Polar Knight!
2 0
Lup☆ doctorbleak
01/24/2017 6:43 PM
Village (Plague)
shovel of hope was fun! hope i have as good of a time with plague of shadows
5 1
mario mario-bros1090
01/24/2017 5:58 PM
Villa
ya casi termino el juego :-)
4 5
jona jonnyfab
01/24/2017 5:43 PM
Villa
shovel knight time
0 0
son msaunders88
01/24/2017 4:47 PM
Stranded Ship
how do you beat polar knight
1 0
NIGHTMARE NIGHTMARRSHOP
01/24/2017 4:10 PM
Encuentro - Baz
baz eres bueno pero no lo suficiente
0 0
NIGHTMARE NIGHTMARRSHOP
01/24/2017 4:02 PM
Explotatorium
solicito a un verdadero reto que me haga perder muchas vidas
0 0
rockon777 SmileyB
01/24/2017 11:35 AM
Bottomless Quarry (Plague)
Plage knights god mode isnt as good as shovel knights.
1 0
hollywood SmartZeus316
01/23/2017 8:57 PM
Plains
first time playing this.... wish me luck
0 0
Jace Jacetendo
01/23/2017 8:36 PM
Plains
Playing on the Wii U
0 0
Nick CookiesKids
01/23/2017 7:53 PM
Tower of Fate: Entrance (Plague)
YES CIPHER COINS!
1 0
Lup☆ doctorbleak
01/23/2017 7:17 PM
Plains
i've been meaning to pick this up for forever now!
0 1
jay oscar171
01/23/2017 4:06 PM
Troupple Pond
this game!! I just cant beat treasure night
0 0
Irispoots iris_poot
01/23/2017 3:24 PM
Plains
I have the sudden irresistible shovel that makes me want to KILL someone NOW! *^* @^@
1 0
Brody bmjeanotte
01/23/2017 3:10 PM
Village
Igot my first meat ticket!
1 0
Irispoots iris_poot
01/23/2017 3:02 PM
Village
1 0
teteu matheusp_br
01/23/2017 2:48 PM
Plains
já zerei isso umas 2000 vezes
0 0
Irispoots iris_poot
01/23/2017 2:46 PM
Armor Outpost
I JUST BEAT TREASURER KNIGHT! FINALY!
3 0
Derfla Derfla12345
01/23/2017 2:38 PM
Tower of Fate: Entrance
woag
2 0
sonictouho sonictouhoufan50
01/23/2017 2:00 PM
Village (Plague)
god mode is best cheat in game sec best is butt butt mode
2 0
Zalen zalenas292
01/23/2017 1:59 PM
Clockwork Tower
0 0
Nick CookiesKids
01/23/2017 1:53 PM
Stranded Ship (Plague)
My new potion of invincibility!!! FINALLY!
1 0
POPFIZZ17 POPFIZZ18
01/23/2017 1:24 PM
Plains
how do i use simmer step
0 0
Monkey LegoMonkeyKing
01/23/2017 12:27 PM
Plains
i did it
0 0
DASB wxmeijer
01/23/2017 9:48 AM
Knuckler's Quarry
How do you dash?!
3 0
Owen lenb813
01/23/2017 5:47 AM
Village (Plague)
Where did mona go?
6 0
gilapo gilapo
01/23/2017 1:14 AM
Iron Whale
1 1
gilapo gilapo
01/23/2017 12:52 AM
Iron Whale
Pro tip: Don't fall into the water
5 0
ethan wilclaw2
01/22/2017 7:55 PM
Explodatorium
times died , 999999889999999999999999999999999999999999999999999999999999999999999999999999999999999
3 0
Bernadette alexandervalley
01/22/2017 4:43 PM
Village
0 0
DA LUREX! psicik777
01/22/2017 4:30 PM
Shivering Sprint (Plague)
i dare YOU (YES YOU!) to do this stage with pandemonium cloak. have fun!
0 0
Josh Ex-Ninten_Fanboy
01/22/2017 4:06 PM
Pridemoor Keep
How many times have I started this game over? I still come back every once in a while.
3 0
Derfla Derfla12345
01/22/2017 2:31 PM
Clockwork Tower
0 0
Owen lenb813
01/22/2017 11:58 AM
Hall of Champions
I beat the hall of champions!
0 0
Burnerz413 Burn3rz
01/22/2017 11:31 AM
Plains
2 0
JoeTheBo JoeTheBo
01/22/2017 11:09 AM
Explodatorium
sPIcY
1 0
Ben benisthecoolest
01/22/2017 9:28 AM
Village
3 0
Cormac NovaWeilder98
01/22/2017 9:27 AM
Flying Machine
0 0
Nick CookiesKids
01/22/2017 8:48 AM
Clockwork Tower (Plague)
Im lovin this new potion
0 0
Nick CookiesKids
01/22/2017 8:02 AM
Armor Outpost
When do i get to be able to see fish head?!?
3 0
Lucky maddsteve8047
01/22/2017 7:51 AM
Village
0 0
Steve swarrior216
01/22/2017 7:22 AM
Plains
You don't scare me Black Knight!!
3 0
shawn clarence1966
01/22/2017 7:17 AM
Pridemoor Keep
YOU STUPID KNIGHT HOW COULD YOU BEAT ME I WILL GET YOU SOME DAY
0 0
shawn clarence1966
01/22/2017 6:58 AM
Pridemoor Keep
0 0
shawn clarence1966
01/22/2017 6:47 AM
The Lich Yard
ill never beat lich knight
0 0
shawn clarence1966
01/22/2017 6:37 AM
The Lich Yard
1 0
shawn clarence1966
01/22/2017 6:10 AM
The Lich Yard
lich yard but why notblich casstle lich knight whay not lich king
1 1
Sir Lems Lemons4Days
01/21/2017 11:47 PM
Plains
hi
2 0
VonKrogh2 VonKrogh2
01/21/2017 8:38 PM
Pridemoor Keep
This game is so cool and chalenging
1 0
Andy Krippin25
01/21/2017 7:51 PM
Bottomless Quarry (Plague)
tongue but hole
2 0
rockon777 SmileyB
01/21/2017 4:53 PM
Troupple Pond
hi just started playing this game:-)
0 0
Daniel? mr.astro36
01/21/2017 4:48 PM
Lost City
2 0
Irispoots iris_poot
01/21/2017 4:19 PM
The Lich Yard
specter knight is really hard, man.
1 0
Salomaum salomaneves
01/21/2017 4:05 PM
Tower of Fate: ????
It's done!
0 0
Salomaum salomaneves
01/21/2017 4:00 PM
Tower of Fate: ????
0 0
Jordan INDESISIVEjew
01/21/2017 3:20 PM
Plains
1 0
sammy neverwell19
01/21/2017 3:07 PM
Iron Whale (Plague)
what even is this fish though
4 0
Sir Yeezy sir_yeezy
01/21/2017 2:06 PM
Plains
how doingbad
2 0
cooper speedycooper
01/21/2017 1:33 PM
Plains
I suk at dis
1 0
Jeff Jcrow323
01/21/2017 1:16 PM
Troupple Pond (Plague)
Tropple king has been met by Plegue
1 0
«Cole» neostorm04
01/21/2017 12:12 PM
Clockwork Tower
just beat tinker knight, we so boss!
1 0
ola ke ase artur_65rodri-45
01/21/2017 11:16 AM
Campiña
hlo
0 0
Alex Kimheng253
01/21/2017 10:23 AM
Explodatorium
I GOT REKTED BY PLAGUE KNIGHT!!!!
0 0
Aldrich Aldrich.exe
01/21/2017 9:13 AM
Campiña
0 0
TheBro PopEye51
01/21/2017 9:01 AM
Troupple Pond
I forgot how to Trouple King.
0 0
Vini vcmoterani
01/21/2017 8:58 AM
Plains
Did it again
0 0
Lucas porkyminch225
01/21/2017 8:37 AM
Explodatorium
custom knight can through booms
0 0
gummy me64 CyclonicDuke
01/21/2017 8:29 AM
Tower of Fate: Entrance
help!!!!
0 0
Audrey Audreyzeller
01/21/2017 5:33 AM
Pridemoor Keep
Can I take his plastic crown?
0 0
BSG-Jay Jay12827
01/20/2017 11:01 PM
Stranded Ship (Plague)
Nearly done with New game plus
0 0
Michael Skarlet-Rogue
01/20/2017 9:03 PM
Plains
boom. shoveled.
0 0
leandro.us leandro.us
01/20/2017 7:49 PM
Village
comprei por download
0 0
leandro.us leandro.us
01/20/2017 7:47 PM
Village
2 0
leandro.us leandro.us
01/20/2017 7:25 PM
Troupple Pond
gostei muito
0 0
. fun9001
01/20/2017 7:00 PM
Clockwork Tower (Plague)
ive found a way to have a shield but its not really helpful
0 0
Grant PurpleChickens77
01/20/2017 6:40 PM
Pridemoor Keep
0 0
Gavin gavinflac
01/20/2017 6:33 PM
Lost City
i FINALLY BEAT IT THE LITCH Of YARD
0 0
Santy_Dz CuentaFake01
01/20/2017 6:06 PM
Finca de Liches
xdxd i won xdxd
0 0
Cameron itisI0
01/20/2017 5:20 PM
Plains
I have lost so many times
0 0
austin austin6709
01/20/2017 5:20 PM
Village
im playing me and my mom
0 0
. fun9001
01/20/2017 3:26 PM
Cog Bounce Chaos
these challenges are really hard anyone else having a hard time on these too?
3 0
nomo Jzl_19
01/20/2017 3:23 PM
Troupple Pond
kl
2 0
gavin gavinsawesome
01/20/2017 2:34 PM
Explodatorium
I'll get revenge on you later, butt butt, when i decide to play as plague butt. (I love the X&BUTT)
2 0
Shark flappingduckz
01/20/2017 1:26 PM
Troupple Pond
2 0
Shark flappingduckz
01/20/2017 12:31 PM
Plains
0 0
jack Wolfbane3
01/20/2017 9:44 AM
Lost City
uuuugggghhh this part on mole knight's stage is harrrrrrdddd
2 0
jayden sergio_vitorino
01/20/2017 6:10 AM
The Lich Yard
1 0
Andy Krippin25
01/19/2017 11:23 PM
The Lich Yard (Plague)
tongue but hole.
1 0
SIXFRIDO SIXFRIDO
01/19/2017 4:31 PM
Villa
Me encanta Shovel Night
2 0
Scott coffeylittle
01/19/2017 4:29 PM
Plains
One of my favorite games of all time.
2 0
Gος†h∞ακηω Akanehibiki
01/19/2017 3:47 PM
Armor Outpost
awesome game the best ¡¡¡¡¡ love it¡¡¡
0 0
Jayz jasonfbowers
01/19/2017 2:54 PM
Plains
This feels so original/good Mega Man yet still so unique unto itself!! I love it!!
1 0
Jeremy Stealthhhunter18
01/19/2017 1:36 PM
Flying Machine
Sir! The Final Battle Approaches! Steel Thy Shovel Sir, and prepare for liftoff!
3 0
Tombstone Tombstone
01/19/2017 10:58 AM
Plains
im da bes
0 0
Jeremy Stealthhhunter18
01/19/2017 8:22 AM
Flying Machine
Sir. . .I'm not the best at jumping puzzles. . .But I'll do my best! lead on, Shovel knight!
3 0
Jeremy Stealthhhunter18
01/19/2017 8:09 AM
Stranded Ship
Stand fast sir! We'll beat him together! -your knight companion
0 0
Jeremy Stealthhhunter18
01/19/2017 8:03 AM
Stranded Ship
Sir, I've read reports that the war horn can be found here. . . Lead on, Sir! We'll take him down!
5 0
trey newtreyman
01/18/2017 5:51 PM
Tower of Fate: Entrance
infinadagger!!
2 0
emry emrynewbz
01/18/2017 5:11 PM
Troupple Pond
oh my cod!
2 0
tj'sgreat tjsgreat
01/18/2017 4:58 PM
Lost City
how do you get past mole knights explosion room where the knight is
0 0
DA LUREX! psicik777
01/18/2017 4:20 PM
Village (Plague)
peacock lady log- that dastardly plague knight came to the hall and the guards lost. >:!! SQUAK!
2 2
Gavin gavinflac
01/18/2017 2:35 PM
The Lich Yard
i hate the lich of yard
1 0
DA LUREX! psicik777
01/18/2017 2:16 PM
Encounter - Phantom Striker (Plague)
easy with spark powder, drop casing, and remote. just stand on edge, dud!
0 0
DA LUREX! psicik777
01/18/2017 2:12 PM
Shivering Sprint (Plague)
did it. but i missed a coin. I WANT YOU PANDEMONIUM CLOAK!! GAAAAA
1 0
DA LUREX! psicik777
01/18/2017 2:07 PM
Shivering Sprint (Plague)
i kind of mess myself up by charging bomb burst here. if i didnt, i could use vat to jump in spots.
0 0
DA LUREX! psicik777
01/18/2017 1:33 PM
Village (Plague)
what is best bomb combonation for you? for me its drop casing, sparkler powder, and remote fuse.
2 1
Monkey LegoMonkeyKing
01/18/2017 12:28 PM
Encounter - Plains
i love this game
1 0
Mansta WafflePi
01/17/2017 8:07 PM
Village
0 0
Sterling SergeKitty
01/17/2017 7:45 PM
Explodatorium (Plague)
Wow, he even calls the Alchemy Coin worthless.
4 0
wonbuu wonbuu
01/17/2017 6:22 PM
Village
juice
1 0
matt Mattabrams21
01/17/2017 5:13 PM
Tower of Fate: Entrance
4 0
McScutton McScutton
01/17/2017 3:34 PM
Plains
ya woo hoo
1 0
ky GO gaming-O
01/17/2017 3:13 PM
Hall of Champions
the game equal to ghost bustors
0 0
Parker roboparker
01/17/2017 1:37 PM
Tower of Fate: Entrance
tower of fate use phase locket for the griffon. you cant hurt him just walk by him and watch out
0 4
Parker roboparker
01/17/2017 1:32 PM
Tower of Fate: Entrance
did you notice on the tower of fate entrance the studs on the wall look like fingers
3 0
katie kmarto86
01/17/2017 1:06 PM
Flying Machine
boom shaka locka somebody call the dr
1 0
John jhonjars
01/17/2017 7:04 AM
Fortaleza del Orgullo
awesome
1 0
★♪Light♪★ megalovania364
01/17/2017 6:11 AM
Nave Varada
soy feliz derrote a polar knight
0 0
alloric solidalloric
01/16/2017 10:04 PM
Armor Outpost
I just saw a fish head shovel knight at the armor outpost
2 0
Bruno skvothe
01/16/2017 8:31 PM
Village
4 0
Justaguy Charmander154
01/16/2017 4:29 PM
Explodatorium
I SWEAR, IF THAT PLAUGE KNIGHT KILLS ME ONE MORE *Beep*ING TIME, I WILL SHOVE THIS SHOVEL INTO HIM!
1 0
Colby clcman03
01/16/2017 3:39 PM
Lost City
how rusty is my weapon now
0 0
Kristoff xXGoldenGamerXx
01/16/2017 3:09 PM
Plains
0 0
Super Ritz SuperRitz
01/16/2017 2:34 PM
Lost City
mole worst digger
0 0
Tunk moman0212
01/16/2017 2:24 PM
Village
i have 6 or 7 peple in my poket i don't know why but i do
1 0
Timmeh Timmehzilla
01/16/2017 2:24 PM
Village
1 0
Śεβα sebapr5
01/16/2017 12:41 PM
Explodatorium
ARE YOU KIDDING ME I DIED RIGHT BEFORE THE LAST CHECKPOINT
3 3
Masonator bigbmn
01/16/2017 12:37 PM
Explodatorium
tfw no gf
0 0
Galax 7777 Galax7777
01/16/2017 11:44 AM
Torre del Hado: Ascensión
que bien que tengo cheats
0 0
Galax 7777 Galax7777
01/16/2017 11:35 AM
Torre del Hado: Entrada
0 0
JonahFrank Animatednerd
01/16/2017 10:41 AM
Iron Whale
This game is way better than new super mario bros ........ in my personal opinion. I love this game.
4 0
nicholas Jason154
01/16/2017 10:38 AM
Dirt Clod Dive
trying to beat dirt clod challenge... SO HARD!!!
3 0
Parker roboparker
01/16/2017 10:25 AM
Stranded Ship
ice area first goldarmor you see lure to the left,shovel drop him him slightly and into the spikes
1 0
Parker roboparker
01/16/2017 10:06 AM
Stranded Ship
use the mobile gear to elevate yourselve to a higher place
0 0
Parker roboparker
01/16/2017 9:57 AM
Stranded Ship
are the ice wolves a problem? jump over them near a bottomless pit
1 0
Parker roboparker
01/16/2017 9:53 AM
Stranded Ship
during mole knight use phase locket
1 0
Parker roboparker
01/16/2017 9:51 AM
Stranded Ship
Having trouble with the ice? just stop moving and jump and you wont slip up ( unless you move again)
2 0
ryan ryancoolgames
01/16/2017 8:55 AM
Pridemoor Keep
Dis game is A DANK MEME
4 0
A Person BraydenCurtis665
01/16/2017 7:59 AM
Explodatorium
exploding rats????
3 0
mitchell jtickle36
01/16/2017 7:50 AM
The Lich Yard
3 0
Lucas 3kidsma
01/16/2017 7:33 AM
Plains
look it i
0 0
A Person BraydenCurtis665
01/16/2017 7:33 AM
Iron Whale
3 0
A Person BraydenCurtis665
01/16/2017 7:28 AM
Iron Whale
oooooo a chest.
1 0
Lucas 3kidsma
01/16/2017 7:28 AM
Plains
ok
0 0
A Person BraydenCurtis665
01/16/2017 7:27 AM
Iron Whale
i dont get how shovel knight could breath underwater, same witg mario.
1 0
A Person BraydenCurtis665
01/16/2017 7:24 AM
Iron Whale
i really DIG this game :3
3 0
FatMAN JawzGang
01/16/2017 6:04 AM
Frigid Flight
Tryna beat the level that you need the proppeler dagger for!
2 0
Ry coolcooldude1324
01/15/2017 9:59 PM
Village
just got on bout like an hour ago. its really fun, very addicting. 13/10
2 0
Raf Banhartday
01/15/2017 9:14 PM
The Lich Yard (Plague)
12 1
cambo nitebourne
01/15/2017 7:07 PM
Explodatorium
thy plague knight is murded with a shovel
2 0
cambo nitebourne
01/15/2017 5:25 PM
Pridemoor Keep
thye king night is murded with a shovel
0 0
Verel Zeldamaster3789
01/15/2017 5:20 PM
Tick Tock Tower
I HATE IT
0 0
cambo nitebourne
01/15/2017 5:02 PM
Plains
thy i beat the black night
0 0
Victhor Dolce_Vida
01/15/2017 4:43 PM
Plains
A new shovel adventure is about to begin!!
0 0
The King NoOtherOption
01/15/2017 4:38 PM
Tower of Fate: Ascent
3 0
Maximus thepiggywithtoph
01/15/2017 4:25 PM
Village
its ya boi goat man
4 0
Maximus thepiggywithtoph
01/15/2017 4:21 PM
Village
its ya boi
0 0
Em Crusher22
01/15/2017 3:50 PM
Plains
2 0
Kyle kdude2704
01/15/2017 3:08 PM
Clockwork Tower
If Shovel Knight is the same height as Tinker Knight, why does he call him little?
0 0
Derp James epicdoodle
01/15/2017 3:05 PM
Plains
I just beat Black Knight for like the 27th time.
1 0
Axel KissMineAxe
01/15/2017 3:04 PM
Troupple Pond
THE TROUPLE KINGS MOM WAS A APPLE AND HIS DAD IS A TROUT
2 0
miko MikoGordon
01/15/2017 2:38 PM
Explodatorium
Chaos sphere is good against plague knight
0 0
vincnt tohm52222
01/15/2017 1:52 PM
Forest of Fishing (Plague)
if you want to unlock every thing enter this as your porfile name( tvsvueio)
4 0
Max Swagmast3r91
01/15/2017 1:43 PM
Village
hi peps
1 0
Caleb Caleb1.6600
01/15/2017 1:06 PM
Tower of Fate: Ascent
I never want to do that again either
2 0
Caleb Caleb1.6600
01/15/2017 12:57 PM
Tower of Fate: Ascent
check point... I never want to do that again. EVER.
3 0
Robert Rjazz64
01/15/2017 12:33 PM
Explodatorium
That was much easier than I thought it would be!
1 0
Barizon Bariz0n
01/15/2017 12:16 PM
Plains
kkkkk
3 0
mitchell jtickle36
01/15/2017 11:53 AM
Plains
u
1 0
shane discodivafever
01/15/2017 10:47 AM
Plains
shevel nght is so kool
5 1
daddy Bonhammer
01/15/2017 10:32 AM
Village
0 0
Trey TMman1
01/15/2017 9:08 AM
shortcut?
Onward to the Tower of Fate! Here we go.
3 0
Jess nerdypanda13
01/15/2017 8:15 AM
The Lich Yard
man i am BAD at this level!
1 0
Garon GaronTheGreat
01/15/2017 8:08 AM
Plains
yolo
1 0
Trey TMman1
01/15/2017 7:43 AM
Armor Outpost
And that wraps up this area! I'll be starting with Tinker Knight first.
4 0
issac diamondgeko
01/15/2017 7:34 AM
Plains
for all the new game plus players: PROPELLER DAGGER OP
2 0
Axel KissMineAxe
01/15/2017 7:16 AM
Troupple Pond
2 0
Axel KissMineAxe
01/15/2017 7:12 AM
Troupple Pond
1 0
Aidan AidanLawrence1
01/14/2017 11:39 PM
The Lich Yard
2 0
ROLLEE X Rollee
01/14/2017 8:01 PM
Village
Can't wait for the new DLC! Coming soon...
4 0
Connor Connor1238
01/14/2017 7:09 PM
Armor Outpost
I asked an old man about his hat collection and he shot lasers at me. What is this
2 0
Connor Connor1238
01/14/2017 5:51 PM
Iron Whale
Just beat Treasure Knight. The Manta Rays will haunt me for years to come.
0 0
jamie saint789
01/14/2017 4:27 PM
Village
new too two player
0 0
Nick CookiesKids
01/14/2017 3:26 PM
Village
Steel Thy Shovel!
1 0
Zack merritt46
01/14/2017 3:23 PM
Village
Great game!
0 0
Marcy WolvesRule123
01/14/2017 2:48 PM
Explodatorium
5 0
EdGe BoY skoogs
01/14/2017 2:40 PM
Flying Machine
I made up a version of this song, but about keemstar
0 0
EdGe BoY skoogs
01/14/2017 2:36 PM
Flying Machine
Hows life
1 0
Axel KissMineAxe
01/14/2017 2:03 PM
Iron Whale
treasure knight so hard
3 0
Axel KissMineAxe
01/14/2017 2:02 PM
Iron Whale
1 0
Pyrodawg lambertus106
01/14/2017 1:07 PM
The Lich Yard
Just beat Specter Knight
0 0
Nolan nhaberstroh05
01/14/2017 12:50 PM
Armor Outpost
Mr. hat is so easy to beat, so just pay the people in the store to fight him, and get 200Gold!
5 0
Yosef DormantRabbits
01/14/2017 12:47 PM
Armor Outpost
armor upgrade!
2 0
Fanta8000 Fanta8000
01/14/2017 12:08 PM
Flying Machine
1 0
awesomeguy awseomeskater8
01/14/2017 11:46 AM
Pridemoor Keep
0 0
trey Treyens
01/14/2017 11:17 AM
Explodatorium
rat brigade
1 0
Brayden bulletbillguy
01/14/2017 11:10 AM
Forest of Phasing
0 0
Thundar yoshi30849
01/14/2017 10:28 AM
Clockwork Tower (Plague)
wow i did not get better after this long
1 0
Enderdrew djsweep41
01/14/2017 9:56 AM
Armor Outpost
I defeated a HAT SELLER?
1 0
Enderdrew djsweep41
01/14/2017 9:48 AM
Lost City
I just defeated mole knight!
0 0
soy sauce irislina
01/14/2017 9:48 AM
Village
wow shovel puns!!!!!!
1 0
Pyrodawg lambertus106
01/14/2017 9:41 AM
Plains
Black Knight's beat me twice already!!!
2 0
Nolan nhaberstroh05
01/14/2017 9:16 AM
Pridemoor Keep
All hail the troupple king!
0 0
Enderdrew djsweep41
01/14/2017 8:27 AM
The Lich Yard
I just defeated the boss!!
1 0
Ty Baldwin67
01/14/2017 8:20 AM
Explodatorium
i finally beat plague knight!!!!
1 0
Enderdrew djsweep41
01/14/2017 8:13 AM
The Lich Yard
I just got this game and it rocks!
1 0
liam liamlulamaeve
01/14/2017 6:13 AM
Pridemoor Keep
lol i Am such a noob
2 0
liam liamlulamaeve
01/14/2017 6:04 AM
Troupple Pond
lol so hard
0 0
midnight shadowperson17
01/13/2017 7:23 PM
Troupple Pond
4 0
Kooper Chickenkoops
01/13/2017 7:19 PM
Plains (Plague)
man its hard getting the knack for jumping
3 0
midnight shadowperson17
01/13/2017 6:11 PM
Armor Outpost
7 0
blake uahuff70
01/13/2017 4:40 PM
Pridemoor Keep
How did I write this? I'm dead!
2 0
gianni valerock
01/13/2017 2:17 PM
Villa
siempre acude donde el gastronomo...
3 0
chuchundra skylandersdjosue
01/13/2017 1:41 PM
La Ciudad Perdida
¡Un nivel increible!
2 0
Retro B. retrobeetle
01/13/2017 12:46 PM
Rematch: Enchantress
When you jump to deal the final blow... and lose the rest pf your health, instead.
2 0
Retro B. retrobeetle
01/13/2017 12:10 PM
Rematch: Tinker Knight
They don't give you the Mobile Gear for this battle, but luckily I'm pretty good at the Tank form.
4 0
Retro B. retrobeetle
01/13/2017 11:38 AM
Cog Bounce Chaos
Always remember the words of the great Shovel Knight: OH DANG I'M DOOMED THERE'S NO WAY AAAAaaaaa...
4 0
Jacob Jacobpf26
01/13/2017 11:29 AM
Frigid Flight
No thank you I am free to fly and then oh you know fall down a pit
2 0
Marcus MarcusonwiiU
01/13/2017 10:20 AM
The Lich Yard
spoopy
0 0
Jay 1-Up4Life
01/13/2017 10:16 AM
Village
First time playing. It's..... SO good, lol
2 0
frogman hadrosaur18
01/13/2017 9:31 AM
Plains
this is awesome
2 0
XanDeR piewizard13
01/12/2017 7:34 PM
Tower of Fate: ????
this game stresses me out.
3 0
lando Frijolitolando
01/12/2017 7:34 PM
Lost City
omg ala primera
1 0
XanDeR piewizard13
01/12/2017 5:54 PM
Stranded Ship
day 37 im confronting polar knight.Should have brought a coat. metal armor does little for the cold.
2 0
Sirerror CreeperJN1
01/12/2017 4:22 PM
The Lich Yard
4 0
Ethan EthanSamK
01/12/2017 4:11 PM
Pridemoor Keep
PREPARE FOR BATTLE KING KIGHT! For I am coming for you now.
3 0
Sirerror CreeperJN1
01/12/2017 4:00 PM
Plains
3 0
Sirerror CreeperJN1
01/12/2017 3:56 PM
Lost City
4 0
Sirerror CreeperJN1
01/12/2017 3:54 PM
Stranded Ship
1 0
Sirerror CreeperJN1
01/12/2017 3:50 PM
Iron Whale
2 0
Ethan EthanSamK
01/12/2017 3:47 PM
Pridemoor Keep
There is no greater warrior the the Propeller Rat.
2 0
Sirerror CreeperJN1
01/12/2017 3:40 PM
Explodatorium
2 0
Sirerror CreeperJN1
01/12/2017 3:36 PM
Flying Machine
1 0
Sirerror CreeperJN1
01/12/2017 3:29 PM
Pridemoor Keep
2 0
Geewash Geewash
01/12/2017 3:29 PM
The Lich Yard
Shovel knight is the best pixelated game ever
1 0
Sirerror CreeperJN1
01/12/2017 3:23 PM
Clockwork Tower
8 0
Matt MattNJack
01/12/2017 2:52 PM
Explodatorium
Me browsing on eshop: shovel knight? sounds easy! gets stuck on plague knight for 7 years
0 0
Rowan Rowly07
01/12/2017 2:44 PM
Pridemoor Keep
i killed dark knight a while a go
0 0
Ethan EthanSamK
01/12/2017 2:33 PM
Plains
Treasure keeps falling down the pits.
2 0
Matt MattNJack
01/12/2017 2:32 PM
Explodatorium
does anyone have any tips on how to beat plague knight?
2 0
X-Ramz SuperRam98
01/12/2017 2:17 PM
Nave Varada
Hola
0 0
buddycullm buddycull
01/12/2017 1:54 PM
Tower of Fate: ????
custom knight rules!!!
2 0
lozmaster legendofcool
01/12/2017 11:20 AM
Village
i just beat the game!
1 0
cristian cussumbo
01/12/2017 7:41 AM
Campiña
derrote al jefe
0 0
cristian cussumbo
01/12/2017 7:23 AM
Campiña
se puede jugar con plage knight
2 0
cristian cussumbo
01/12/2017 7:21 AM
Campiña
un buen juego y la 3ds
0 0
Gman elastor1983
01/11/2017 9:11 PM
Hall of Champions
the best 8-bit game!!
0 0
Cody iBearAttack
01/11/2017 6:00 PM
Tower of Fate: ???? (Plague)
It is so hard with the Pandemonium Cloak that its funny to me.
0 0
Beebs robotninjaguy
01/11/2017 5:57 PM
The Lich Yard
1 0
Peyton P-Whiz
01/11/2017 3:45 PM
Explodatorium
0 0
austin austin6709
01/11/2017 1:34 PM
The Lich Yard
0 0
Hunter turtlesarebae
01/11/2017 8:24 AM
Pridemoor Keep (Plague)
2 0
Jamess135 Jakelson15
01/11/2017 1:24 AM
Hall of Champions
1 0
Felix BlackmageFelix
01/10/2017 6:20 PM
Troupple Pond
Sexy
1 0
Felix BlackmageFelix
01/10/2017 6:11 PM
Pridemoor Keep
Yes.
2 0
Scott minecrafty30
01/10/2017 3:11 PM
Flying Machine
this very stage i have 99999 GOLD
3 0
Joe jfprophet
01/10/2017 2:25 PM
Pridemoor Keep
0 0
Cam CubicChron
01/10/2017 2:21 PM
The Lich Yard
3 0
ryan rhino0629
01/10/2017 2:19 PM
Plains
even the first boss is hard
0 0
Shawn ShawnHarvey
01/10/2017 2:17 PM
Plains
Ryan1dkdeoddotajç.$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$
3 0
Sketch boston9876
01/10/2017 1:20 PM
Village
I beat king knight!
2 0
Chad ChadO1976
01/10/2017 1:17 PM
Troupple Pond
lol
0 0
marek vulfinstine
01/10/2017 1:06 PM
Iron Whale
this game is hard
2 0
Galax 7777 Galax7777
01/10/2017 11:20 AM
La Ciudad Perdida
Aaaaaaaa el nivel es muy difícil incluso la vatalla contra mole knite
0 0
kam Kamlola
01/10/2017 10:13 AM
Village
cools game so cool
4 0
Santi batusaurus.rex
01/10/2017 9:57 AM
Armería
0 0
emo kitty dantheman900000
01/10/2017 4:32 AM
Plains
how do you change your post avatarr
1 0
Shawn ShawnHarvey
01/09/2017 9:48 PM
Plains
Ryan1
0 0
Rovo~Alien SirHamTheInkling
01/09/2017 7:45 PM
Explodatorium
0 0
Micah 2fab4you74
01/09/2017 7:39 PM
Stranded Ship
0 0
Full Tilt Collasta
01/09/2017 6:57 PM
Pridemoor Keep
Leave Gryffon alone!
0 0
Rovo~Alien SirHamTheInkling
01/09/2017 5:42 PM
Knuckler's Quarry
0 0
Shy Guy Megalo963
01/09/2017 5:17 PM
Torre del Hado: Ascensión
Bueno... ¿ahora que?
4 0
Caleb Caleb1.6600
01/09/2017 4:22 PM
The Lich Yard
whenever you face a great (but not boss) challenge, remember these words... aim for the head
1 0
Fox Foxicus
01/09/2017 3:00 PM
Tower of Fate: Entrance
1 0
Beckysroll Beckysroll
01/09/2017 11:52 AM
The Lich Yard
0 0
Jessica flaminfiretrucks
01/09/2017 11:21 AM
Iron Whale
0 0
dany supamadio3dworld
01/08/2017 8:35 PM
Villa (Plague)
este juego es mejor que migthy no 9
2 0
Sirerror CreeperJN1
01/08/2017 6:56 PM
The Lich Yard
3 0
Tyler BagelBoy17
01/08/2017 6:21 PM
Troupple Pond
Met the Troupple King! Awesome!
2 0
Caleb Caleb1.6600
01/08/2017 5:33 PM
Plains
I love that animation
1 0
Caleb Caleb1.6600
01/08/2017 5:25 PM
Plains
best strategy: do a diving attack repeatedly on it's head
1 0
Engineer WarlordWailord
01/08/2017 3:30 PM
Pridemoor Keep
day 200, they still dont know i kill for hats
3 0
Fox Foxicus
01/08/2017 3:25 PM
Clockwork Tower
1 0
☆kiki☆ kiki_wii_pro
01/08/2017 3:00 PM
Explodatorium
hello
1 0
Fox Foxicus
01/08/2017 2:21 PM
Stranded Ship
1 0
Fox Foxicus
01/08/2017 2:14 PM
Stranded Ship
2 0
Link abdielyadrian
01/08/2017 2:12 PM
Explodatorium
Hes so Stoge
0 0
Caleb Caleb1.6600
01/08/2017 2:05 PM
Plains
sooo I can just stay here and sleep? okay. I'll just rescue shield knight in my dreams then
1 0
Link abdielyadrian
01/08/2017 1:24 PM
Forest of Phasing
L L Good At This Game
0 0
Saad saadrahat
01/08/2017 1:23 PM
Tower of Fate: Entrance
IM GOING TO BURY YOU!!!
0 0
Duchaaa Martin3211
01/08/2017 11:30 AM
Armería (Plague)
qye nadie ha jugado este modo, solo es un poco mas retador
3 0
DarthR0xas ultimax2.0
01/08/2017 8:49 AM
Tower of Fate: Entrance
Pazoozo
2 0
Axel KissMineAxe
01/08/2017 7:27 AM
Pridemoor Keep
I got this for my birthday it is fun and my birthday is january 8th ü
0 0
Axel KissMineAxe
01/08/2017 7:25 AM
Pridemoor Keep
2 0
Axel KissMineAxe
01/08/2017 7:23 AM
Pridemoor Keep
1 0
Robby seacapter
01/08/2017 6:48 AM
The Lich Yard
Spikes messing me up yo
0 0
Axel KissMineAxe
01/08/2017 6:26 AM
Plains
0 0
Connor dadbartels
01/08/2017 3:32 AM
Pridemoor Keep
what wher they thinking with a shovle for his weapon
0 0
k47x rm7xever7
01/07/2017 8:48 PM
Campiña
Me gusta este juego!!!
2 1
Satan Cryoworks
01/07/2017 8:00 PM
Plains
I defeated the Black Knight on the second try!
1 0
herobrine herobrine0025
01/07/2017 7:11 PM
Tower of Fate: Entrance
cant get past book part AT BEGINNING
1 0
Devin Jennelle1228
01/07/2017 5:45 PM
Explodatorium (Plague)
The obligatory Shovel Knight fight you will never win, but you can still take his dragon ball
3 0
spike wildman5150
01/07/2017 5:43 PM
The Lich Yard
1 0
Devin Jennelle1228
01/07/2017 5:35 PM
Troupple Pond (Plague)
Magic apple fish king... I pray to thee to give me the power to dance!
2 0
spike wildman5150
01/07/2017 5:32 PM
The Lich Yard
AAAAAAAAAAAAAAAAAA
0 0
Devin Jennelle1228
01/07/2017 5:28 PM
Armor Outpost (Plague)
just use pressure and watch them run, and or get hit off the screen but that works too
2 0
Devin Jennelle1228
01/07/2017 5:20 PM
Encounter - Reize (Plague)
dat boi dou
2 0
Shocky yffikhj
01/07/2017 4:14 PM
Troupple Pond
This is so FUN with codes.
0 0
Gabriel swimmerdude10
01/07/2017 4:01 PM
Lost City
How do you use the dust knuckles?
2 1
bob64 munrobiswal
01/07/2017 3:47 PM
Plains
3 0
Dman jijiww
01/07/2017 3:35 PM
The Lich Yard
But its not my time yet im still young
1 0
Star4Mewni anicka1234
01/07/2017 2:49 PM
The Lich Yard
5 0
Luke PokeLuke1
01/07/2017 2:41 PM
Plains
Im so close
1 0
brayden rocket5454
01/07/2017 1:23 PM
Troupple Pond
Its a trout and a apple
3 0
Ceecee jomebrome01
01/07/2017 1:17 PM
Plains
0 0
drew RedTigers
01/07/2017 1:00 PM
Flying Machine
ALL HAIL THY TROUPPLE KING!!
0 0
John minecraftlova12
01/07/2017 12:16 PM
Village
Was it the G-Chord? No no! Hmm, if shovel knight keeps collecting these music sheets ill be broke!
4 0
S-MAN RamFam1855
01/07/2017 10:34 AM
Lost City
ONE TIME MOLE KNIGHT FINISHED
0 0
S-MAN RamFam1855
01/07/2017 9:44 AM
Encounter - Baz
Baz is done
1 0
EndlessMik michaelj36
01/07/2017 9:42 AM
Clockwork Tower
curse you auto-scrolling rooms!!! curse you
2 0
S-MAN RamFam1855
01/07/2017 9:34 AM
Encounter - Reize
Reize was hard but i beat her!
0 0
Brandon shovelknight9999
01/07/2017 9:22 AM
Explodatorium (Plague)
this stage is now harder with plague knight! And it was hard to beat to begin with
1 0
Kentpine Kentpine
01/07/2017 9:20 AM
Village
0 0
Chris.M. cjm1201
01/07/2017 8:03 AM
The Lich Yard (Plague)
word of the wise don't forget to get the items it'll make it much more easy ~P. Knight
0 0
Aidan aidan_doyle
01/07/2017 8:01 AM
Lost City
Every video game has lava.
6 1
RivCA RivCANuke
01/07/2017 4:59 AM
Plains
And so begins a new Knight's tale, the Amiibo Knight!
0 0
Anthony antman182
01/06/2017 10:09 PM
Plains
i just kept spamming my fire attack and i beat him
0 0
Andrew jeven7
01/06/2017 9:30 PM
Plains (Plague)
IT'S NOT LIKE I DIED IN THE PLAINS MOM!
1 0
Poliver Polivers
01/06/2017 9:01 PM
Campiña
0 0
Link abdielyadrian
01/06/2017 8:11 PM
Pridemoor Keep
Good
2 0
Jonathan Baranov13
01/06/2017 7:55 PM
Pridemoor Keep
1 0
Link abdielyadrian
01/06/2017 7:43 PM
Plains
I Link You Dark Knlght
0 0
Thomas 3rd Thomas6800
01/06/2017 7:40 PM
Clockwork Tower
This music... Makes me think of autoscrollers. I don't really know why, but it does to me.
4 0
Trin TrinRaw120
01/06/2017 7:36 PM
Plains (Plague)
I died...in the plains. Of all the places!
2 0
midnight shadowperson17
01/06/2017 6:46 PM
Iron Whale
2 0
Casey vapequeen87
01/06/2017 6:29 PM
Plains
1 0
Star4Mewni anicka1234
01/06/2017 6:09 PM
Pridemoor Keep
1 0
Alex FlavoryLeech
01/06/2017 5:00 PM
Village
Good luck fellow Knight!
2 0
sergio klonoayami
01/06/2017 4:47 PM
Fortaleza del Orgullo
yo me lo pase en la version de pc es fasil
2 0
FooF FooF123
01/06/2017 3:45 PM
Troupple Pond
Its fish and a apple i think i can say ive seen everything
2 0
Star4Mewni anicka1234
01/06/2017 12:30 PM
Plains
3 0
Star4Mewni anicka1234
01/06/2017 12:26 PM
Plains
2 0
Santi batusaurus.rex
01/06/2017 12:08 PM
Máquina Voladora
1 0
Santi batusaurus.rex
01/06/2017 11:56 AM
Máquina Voladora
mine
1 0
Star4Mewni anicka1234
01/06/2017 11:50 AM
Plains
GRRRRRRRRRRRR I LOST ALL MEH MONEY '~'
2 0
Santi batusaurus.rex
01/06/2017 11:19 AM
Torre Mecánica
odio los caballeros
0 0
lando Frijolitolando
01/06/2017 8:51 AM
Explodatorium
2 0
lando Frijolitolando
01/06/2017 8:23 AM
Pridemoor Keep
ala primera
0 0
lando Frijolitolando
01/06/2017 8:03 AM
The Lich Yard
me encanta esta pelea
2 0
Joey Joey-GamerZX-111
01/06/2017 7:55 AM
Plains
This is an awesome game!!
2 0
Trin TrinRaw120
01/06/2017 7:33 AM
Plains
Black Knight is defeated. King Knight is next!
0 0
Yano mr.super2099
01/05/2017 9:33 PM
Iron Whale
I hate this level... this game is REALLY hard.
2 0
spider widowrosebud
01/05/2017 8:31 PM
Plains
0 0
spider widowrosebud
01/05/2017 8:26 PM
Plains
1 0
Blade ForeverBlade
01/05/2017 7:51 PM
Iron Whale
Shovel knight rocks
3 0
Sebas Sea_Bass223
01/05/2017 7:07 PM
Tower of Fate: Entrance
I am on the Enchantress' Tower Entrance!
4 0
Bailey RoboGuy
01/05/2017 7:01 PM
Plains
2 0
Benji Maxibird123
01/05/2017 4:43 PM
The Lich Yard
beat specter knight
0 0
daddy iceberg321
01/05/2017 3:36 PM
Plains
0 0
Tom leonidasdecree
01/05/2017 1:22 PM
Pridemoor Keep
good for you Roni
2 0
Tom leonidasdecree
01/05/2017 1:19 PM
Pridemoor Keep
king knight is so small and week
1 0
sans lalospace
01/05/2017 1:14 PM
Torre del Hado: Ascensión
2 0
Ex3vd ex3vdzero
01/05/2017 11:34 AM
Flying Machine (Plague)
0 0
Guido Nedyak12359
01/05/2017 8:48 AM
The Lich Yard
pass the salt
1 0
konata yoshokibo
01/05/2017 8:43 AM
Lost City
got hit by two slimes died in a fire
1 0
konata yoshokibo
01/05/2017 7:55 AM
Explodatorium
1 0
loki bradleyloki
01/05/2017 7:28 AM
Explodatorium
i hate my job
0 0
Animer linkgamer03
01/05/2017 6:33 AM
Troupple Pond
This King is soo cool !
0 0
Lucas KingJinjo
01/05/2017 5:55 AM
The Lich Yard
So hard!
0 0
Harrison jhunse
01/04/2017 5:10 PM
Troupple Pond
2 0
Gage Gage010
01/04/2017 4:08 PM
Plains (Plague)
cant wait for spectar of torment!
3 0
Zach Zefolas
01/04/2017 4:01 PM
Plains (Plague)
Woah, had no idea Plague of Shadowswas a thing! Its really cool
0 0
rubs Ruben35
01/04/2017 3:33 PM
Campiña
ta genial
4 1
konata yoshokibo
01/04/2017 3:33 PM
Plains
0 0
Santi batusaurus.rex
01/04/2017 1:32 PM
Explotatorium
ahhh yhea
0 0
Santi batusaurus.rex
01/04/2017 1:07 PM
Explotatorium
0 0
Santi batusaurus.rex
01/04/2017 12:54 PM
Explotatorium
fuegoooooo
0 0
Santi batusaurus.rex
01/04/2017 11:47 AM
Finca de Liches
0 0
Francisco Francisco35
01/04/2017 11:47 AM
Iron Whale (Plague)
Plague of Shadows is so much fun!
0 0
Santi batusaurus.rex
01/04/2017 11:13 AM
Finca de Liches
1 0
Tom leonidasdecree
01/04/2017 8:20 AM
Troupple Pond
my brother william loves the flying rats
2 0
Tom leonidasdecree
01/04/2017 8:14 AM
Village
I made a copy of my shovel knight wourld for my brother william!!
2 0
Tom leonidasdecree
01/04/2017 8:12 AM
Village
yesterday I BEAT KING KNIGHT!!!
5 0
Tom leonidasdecree
01/04/2017 8:10 AM
Village
how do you beat the grifon
0 2
Tom leonidasdecree
01/04/2017 8:09 AM
Village
gastrononer,s food is very yummy!
1 0
Francisco Francisco35
01/04/2017 8:02 AM
Plains (Plague)
unlocked plague knight!
1 0
Francisco Francisco35
01/04/2017 7:51 AM
Explodatorium
where's plauge knight's relic?!?!?
2 0
Ruben SodiumMeister
01/03/2017 9:14 PM
Tower of Fate: ????
tmw you accidently set it to tv only and the tv is in the other room in THE MIDDLE OF THE FFIGHT
1 0
Ruben SodiumMeister
01/03/2017 5:27 PM
Clockwork Tower
do not use the propeller dager to get thr check point. trust me.
1 0
Xain p1km1n56
01/03/2017 5:17 PM
Encounter - Baz
1 0
S-MAN RamFam1855
01/03/2017 5:13 PM
Iron Whale
How do you use trouples?
2 2
samandalex cowboyfans16
01/03/2017 5:04 PM
The Lich Yard
found you
2 0
matthew sqidkid777
01/03/2017 4:14 PM
The Lich Yard
0 0
Xain p1km1n56
01/03/2017 2:57 PM
Explodatorium
Man this level is hard!
1 0
Dj mask RunHomeJack23
01/03/2017 2:50 PM
Plains
i have fun on this game
0 0
Zamu™Fx13 zakumij
01/03/2017 2:22 PM
Ballena de Hierro (Plague)
I Love this game! :D
1 0
Ruben SodiumMeister
01/03/2017 1:42 PM
Flying Machine
wheres the bleach
6 0
CHIDARTO CHIDARTO
01/03/2017 12:12 PM
Campiña
Comenzando ;)
3 0
Miguelito alex.lopezlim
01/03/2017 11:56 AM
Troupple Pond
I started soooooo badddddd!!!!
1 0
robert MinecraftAngry
01/03/2017 10:13 AM
Stranded Ship
polor knight is so hard
1 0
Ostrich JOHNSONFAM0023
01/03/2017 9:42 AM
Plains
ddfbrfffr yggthf ugtnfèöí(4 í5]ü)
1 0
Elliot CheesMaster
01/03/2017 9:27 AM
Armor Outpost
that was an easy boss
0 0
Ostrich JOHNSONFAM0023
01/03/2017 9:12 AM
Plains
I was so happy when i got this wii u
1 0
Ostrich JOHNSONFAM0023
01/03/2017 9:06 AM
Plains
hello friends
2 0
Justin epicsause21
01/03/2017 6:58 AM
Plains
This game is awesome!
1 0
JARED Wilma.W
01/03/2017 6:10 AM
Ballena de Hierro
The level was insanely hard.... and I beated the boss at the first try :'(
0 0
supermario Craxii
01/02/2017 10:50 PM
Cog Bounce Chaos
I THINK I DIED AT THE LAST EDGE!!!
1 0
Christian Abbott2014
01/02/2017 6:33 PM
Plains
shovel
0 0
ToonKaos karebear131
01/02/2017 3:22 PM
Plains
Love this game so far!
1 0
supermario Craxii
01/02/2017 3:19 PM
Birder Herder
The pattern is UL LL UR LR !!!!!!!!!!!
0 0
Jacob Jacoby_r2
01/02/2017 2:42 PM
The Lich Yard
Fun
0 0
supermario Craxii
01/02/2017 2:14 PM
Double Bubble
nnnnnnnoooooooooo!!!!!!!!!
0 0
supermario Craxii
01/02/2017 2:06 PM
Double Bubble
0 0
Niko Nbkoy24
01/02/2017 1:30 PM
Pridemoor Keep
Get ruined king knight!
0 0
Alan Dshadow66
01/02/2017 1:12 PM
Lost City (Plague)
I love playing as Plague Knight
1 0
Dani Oh_Boy_08
01/02/2017 1:12 PM
Stranded Ship
Game Grumps.
1 0
Dani Oh_Boy_08
01/02/2017 1:06 PM
Clockwork Tower
His stage 2 though
4 0
Cool_gamer ltyson
01/02/2017 1:04 PM
Pridemoor Keep
2 0
mr banana owengrey
01/02/2017 12:58 PM
Plains
black khight is so hard
2 0
Dani Oh_Boy_08
01/02/2017 12:53 PM
Clockwork Tower
2 0
Dani Oh_Boy_08
01/02/2017 12:45 PM
Flying Machine
Did it first try but i've played this many times
0 0
Dani Oh_Boy_08
01/02/2017 12:35 PM
Flying Machine
2 0
Nick CookiesKids
01/02/2017 12:25 PM
Lost City (Plague)
Smoke bomb! :D
1 0
Dani Oh_Boy_08
01/02/2017 12:25 PM
Flying Machine
0 0
Gavin GWATS8
01/02/2017 10:28 AM
Pridemoor Keep
Black knight was soo hard
1 0
voldemort jrvw06
01/02/2017 9:59 AM
Lost City (Plague)
i love apples!!!!!
3 0
Rowan Ben. rowan.bentley
01/02/2017 9:26 AM
Clockwork Tower
Just defeated the boss YAS! ps:if you have troupple chalaces go to troupple pond and get the renewal
0 0
brennan cambren99
01/02/2017 8:33 AM
Plains
how do you get past the first boss
2 0
Sterling SergeKitty
01/02/2017 8:19 AM
Tower of Fate: Ascent
I am amazed that I beat them first try.
2 0
David Vakama25
01/02/2017 1:17 AM
Plains
0 0
Juan littleJuan64
01/01/2017 9:34 PM
Plains
This game should win the video game awards this year.
5 0
Galax 7777 Galax7777
01/01/2017 8:02 PM
Villa
ya me comi todos los espoilers ;v
3 0
supermario Craxii
01/01/2017 7:48 PM
Village
I beat black night OP EDITION first try!!!!!!!!!!!!
0 0
jr Gazer76
01/01/2017 6:53 PM
Explodatorium (Plague)
0 0
Rowan Ben. rowan.bentley
01/01/2017 6:51 PM
Armor Outpost
Tip:in the airship you can go to the left to get the music sheet
6 0
william SuperDeal13
01/01/2017 6:37 PM
The Lich Yard
2 0
Fiddle CharizardSparks
01/01/2017 6:19 PM
The Lich Yard (Plague)
15 1
Fiddle CharizardSparks
01/01/2017 5:59 PM
The Lich Yard (Plague)
5 0
eli eli95692
01/01/2017 5:49 PM
Village
3 0
Gage Gage010
01/01/2017 5:20 PM
The Lich Yard
Just started playing Shovel knight and i luvvvv it!!!!!!
0 0
trenton! derpyghost2000
01/01/2017 3:34 PM
Plains
hi
1 0
trenton! derpyghost2000
01/01/2017 3:26 PM
Plains
moo
0 0
Smarty306 nos4r2
01/01/2017 3:19 PM
Plains
0 0
jacob Jmcnally1
01/01/2017 3:10 PM
Hall of Champions
ghost
0 0
littlebudy littlebuddy75
01/01/2017 12:39 PM
Pridemoor Keep
ffrsfrcgws=[/=_$:_!=""++>rn:ú697[):ç
0 0
austin austin6709
01/01/2017 12:24 PM
Plains
T_T I CANT COMPLETE IT
2 0
Cal unicorn109
01/01/2017 11:19 AM
Village
if you go on the very top of the latter and move left and right you can shake your butt
0 0
Lucas porkyminch225
01/01/2017 11:10 AM
Plains
Hello thy neighbors
1 0
Nick NAH1989
01/01/2017 10:50 AM
The Lich Yard
can i not save and come back to this later? i need to defeat the specter knight just need a break.
1 0
Sterling SergeKitty
01/01/2017 10:45 AM
Tower of Fate: Entrance
This is actually super tough!
0 0
Tom mwillia3T
01/01/2017 8:29 AM
Flying Machine (Plague)
OW!
1 0
Bud wasting-my-youth
01/01/2017 7:04 AM
Pridemoor Keep
Use the down attack on the book
0 0
Danzig262 merlinkme262
01/01/2017 6:22 AM
Tower of Fate: Ascent
2 0
Danzig262 merlinkme262
01/01/2017 6:10 AM
Tower of Fate: Ascent
0 0
Danzig262 merlinkme262
01/01/2017 6:03 AM
Tower of Fate: Ascent
0 0
Danzig262 merlinkme262
01/01/2017 5:57 AM
Tower of Fate: Ascent
third checkpoint already?
1 0
Danzig262 merlinkme262
01/01/2017 5:55 AM
Tower of Fate: Ascent
0 0
Danzig262 merlinkme262
01/01/2017 5:52 AM
Tower of Fate: Ascent
0 0
Danzig262 merlinkme262
01/01/2017 5:20 AM
Tower of Fate: Ascent
0 0
paten Paten06
12/31/2016 9:05 PM
Explodatorium
Times died: 9999999999999999999999999999999999999999999999999999999999999999999999999999999999999999
1 0
Deej TheDeejman
12/31/2016 8:35 PM
Clockwork Tower
3 0
Samuel StacyRickman
12/31/2016 7:37 PM
Pridemoor Keep
beat king knight with the horn!
4 0
Lion JeiWulve
12/31/2016 7:13 PM
Plains
i has a shavul
3 0
supermario Craxii
12/31/2016 7:01 PM
Encounter - Phantom Striker
yyyyyyyeeeeeeeessssss!!!!!!! second try!!!!
1 0
supermario Craxii
12/31/2016 6:59 PM
Encounter - Phantom Striker
nooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo!!!!!!!!!!!!!!!!!!!!!!!
1 0
luisale giovaz84
12/31/2016 6:35 PM
Campiña
derrote al jefe
0 0
luisale giovaz84
12/31/2016 6:32 PM
Campiña
):
1 0
luisale giovaz84
12/31/2016 6:29 PM
Campiña
es toy con tra el boos
5 0
luisale giovaz84
12/31/2016 6:13 PM
Campiña
derrote al Dragon de burbujas
3 0
RalStar371 Raleighsfollies
12/31/2016 5:56 PM
Iron Whale
so cool!
1 0
Robert taydeu
12/31/2016 5:48 PM
Village
Make a new file, and call it:X&BUTT
1 0
★SNC☆ TSNG TheSuperNerd05
12/31/2016 5:12 PM
Plains
Tis I, Sir Shovel... Knight?
0 0
Danzig262 merlinkme262
12/31/2016 4:01 PM
Tower of Fate: Entrance
0 0
Danzig262 merlinkme262
12/31/2016 3:59 PM
Tower of Fate: Entrance
0 0
Danzig262 merlinkme262
12/31/2016 3:45 PM
Tower of Fate: Entrance
1 0
Danzig262 merlinkme262
12/31/2016 3:34 PM
Tower of Fate: Entrance
0 0
James JJ_Da_B
12/31/2016 3:11 PM
Pridemoor Keep
firewand rules!! get the big chest!
1 0
matt Msds1988
12/31/2016 2:47 PM
Village
good game hope the second one has sonic 2 tunnels.
0 0
Danzig262 merlinkme262
12/31/2016 1:30 PM
Flying Machine
1 0
Danzig262 merlinkme262
12/31/2016 1:16 PM
Flying Machine
2 0
Danzig262 merlinkme262
12/31/2016 1:04 PM
Flying Machine
3 0
Donnie Donniemonster19
12/31/2016 12:57 PM
The Lich Yard
im playing co-op yay
0 0
Danzig262 merlinkme262
12/31/2016 12:47 PM
Encounter - Phantom Striker
1 0
Smarty306 nos4r2
12/31/2016 12:28 PM
Troupple Pond
3 0
brennan cambren99
12/31/2016 12:24 PM
Plains
awsome!!!
1 0
Danzig262 merlinkme262
12/31/2016 12:12 PM
Flying Machine
0 0
Edulido Edulido
12/31/2016 11:54 AM
Tower of Fate: Ascent (Plague)
Ansioso pelo próximo dlc
0 0
Donnie Donniemonster19
12/31/2016 11:47 AM
Explodatorium
got to level 3
0 0
Nombi nombrano
12/31/2016 11:42 AM
Plains
dark night is hard
2 0
Aryanna ary0725
12/31/2016 11:31 AM
Lost City
plague of shadows be l i t
2 0
Lucas porkyminch225
12/31/2016 11:25 AM
Plains
just got the game
0 0
boy2.o evilboychild
12/31/2016 11:02 AM
Village
you need the shovel knight amiibo
4 0
MajoraHD BURGER2016
12/31/2016 10:08 AM
Pridemoor Keep
there is a easter egg in king knight stage
2 0
Sterling SergeKitty
12/31/2016 10:00 AM
Stranded Ship
Thank Arceus for the Dust Knuckles!
0 0
Fawful Tbone-bomber
12/31/2016 9:37 AM
Explodatorium (Plague)
huh neat i found my room
6 0
Fawful Tbone-bomber
12/31/2016 9:12 AM
Explodatorium (Plague)
hee hee hee. wait if i'm plauge knight who's the b. (REALIZATION) OH HELL NO SHOVEL KNIGHT SHALL DIE
4 0
Fawful Tbone-bomber
12/31/2016 9:06 AM
Explodatorium (Plague)
plauge knights mode way easier the main mode cause i beat it in a fraction of my first run through;)
4 0
Sterling SergeKitty
12/31/2016 8:42 AM
Encounter - Phantom Striker
Wow, that was easy!
0 0
Sterling SergeKitty
12/31/2016 8:40 AM
Clockwork Tower
Super fun boss!
1 0
Lee MrBrake
12/31/2016 7:59 AM
Iron Whale
he is so hard
2 0
Danzig262 merlinkme262
12/31/2016 7:29 AM
Lost City
mole knight? more like no knight.
6 0
Donnie Donniemonster19
12/30/2016 10:36 PM
The Lich Yard
hard is it
2 0
KJR K3v1nR3y3s
12/30/2016 8:11 PM
Village
This games is amazing!
1 0
Danzig262 merlinkme262
12/30/2016 8:00 PM
Iron Whale
0 0
Danzig262 merlinkme262
12/30/2016 7:59 PM
Iron Whale
oops just broke the checkpoint
0 0
Ethan efolzie13
12/30/2016 6:56 PM
Stranded Ship
C'mon people comment on this game!!!
2 0
Danny Kid-Chameleon88
12/30/2016 6:51 PM
Encounter - The Lich Yard
3 0
Mateo Gamemastr1
12/30/2016 6:45 PM
The Lich Yard
Hard!
1 0
Mateo Gamemastr1
12/30/2016 6:44 PM
The Lich Yard
So hard!!! Specter Knight is hard as Ten Billion Mewtwos!
1 0
Skwid-Kid ehungler
12/30/2016 6:43 PM
Stranded Ship
Dude,lets be honest. Treasure Night is totaly a Big Daddy from BioShock.
0 0
Jo jo Android0CPT0
12/30/2016 6:08 PM
Pridemoor Keep
How do you get past the open book part in the second level?
3 3
Danzig262 merlinkme262
12/30/2016 3:37 PM
Pridemoor Keep
0 0
Danzig262 merlinkme262
12/30/2016 3:18 PM
Pridemoor Keep
what the what is with all these magical books laying around so shovel knight can progress?
0 0
Danzig262 merlinkme262
12/30/2016 3:09 PM
Pridemoor Keep
get rekt
2 0
Danzig262 merlinkme262
12/30/2016 3:05 PM
Pridemoor Keep
this level is too easy.
0 0
Danzig262 merlinkme262
12/30/2016 3:01 PM
Pridemoor Keep
0 0
Danzig262 merlinkme262
12/30/2016 2:59 PM
Pridemoor Keep
0 0
Danzig262 merlinkme262
12/30/2016 2:56 PM
Pridemoor Keep
2 0
Danzig262 merlinkme262
12/30/2016 2:49 PM
Village
how do i enter cheat codes?
3 0
Danzig262 merlinkme262
12/30/2016 2:33 PM
The Lich Yard
0 0
Danzig262 merlinkme262
12/30/2016 2:31 PM
The Lich Yard
who turned off the lights?
2 0
Danzig262 merlinkme262
12/30/2016 2:25 PM
The Lich Yard
0 0
Danzig262 merlinkme262
12/30/2016 2:24 PM
The Lich Yard
1 0
Danzig262 merlinkme262
12/30/2016 2:17 PM
The Lich Yard
3 0
joshua joshuarisenhoove
12/30/2016 1:48 PM
Plains
helium
0 1
Danzig262 merlinkme262
12/30/2016 1:44 PM
The Lich Yard
2 0
Danzig262 merlinkme262
12/30/2016 1:28 PM
The Lich Yard
0 0
Sean TheFreakingWarbo
12/30/2016 11:18 AM
Tower of Fate: Ascent (Plague)
Vat and uppercut staff are king here.
1 0
3 eye manman155
12/30/2016 10:46 AM
Troupple Pond
ima flying rat
2 0
Jackson vanwaveren
12/30/2016 10:44 AM
The Lich Yard
this game is slightly difficult...
2 0
3 eye manman155
12/30/2016 10:38 AM
Pridemoor Keep
beat king knite
0 0
3 eye manman155
12/30/2016 10:37 AM
Pridemoor Keep
0 0
3 eye manman155
12/30/2016 10:35 AM
Pridemoor Keep
help i cant beat king knite
0 0
Vicki BESERKSAIX
12/30/2016 10:35 AM
Plains
1 0
Ruben SodiumMeister
12/30/2016 10:07 AM
Plains
i got this game and im dying on the first level thats nice welcome to demon souls.
4 0
Green GreenPowerStar
12/30/2016 9:38 AM
Pridemoor Keep
King? Ha! Black Knight was more of a challenge.
1 0
Sterling SergeKitty
12/30/2016 7:57 AM
Troupple Pond
Hail the troupple king!
1 0
Sterling SergeKitty
12/30/2016 7:31 AM
Plains
Awesome game so far!
1 0
Pro. Oak Iowarulez
12/30/2016 7:24 AM
Stranded Ship
Iffinadagger!
1 0
isaac Bobcat0605
12/30/2016 7:23 AM
Stranded Ship
0 0
Joe sbygbduvrj41843t
12/30/2016 6:01 AM
Stranded Ship
NO
4 0
kevin K_Square3126
12/30/2016 2:28 AM
Lost City
0 0
Link_BotW5 00969a
12/29/2016 8:54 PM
Flying Machine (Plague)
jflxakdnc im so mad and sad because propeller nights ship is so hard
1 0
Colton thelonelymidget
12/29/2016 8:12 PM
Tower of Fate: Ascent
sorry to crash the party bois
2 0
Duchaaa Martin3211
12/29/2016 7:12 PM
Armería
la armadura dorada solo te hace popular y princeso
0 0
Duchaaa Martin3211
12/29/2016 7:10 PM
Mansión de los Campeones
si pagan recuerden llevar posiones de icores, ADEMAS hay paredes falsas prendas las habitaciones
0 0
Nick CookiesKids
12/29/2016 6:51 PM
Plains (Plague)
BOOOOM!!! XD
1 0
Nick CookiesKids
12/29/2016 6:34 PM
Double Bubble
I gotta feel it
0 0
Mercetron Mercetron
12/29/2016 6:28 PM
Stranded Ship
It seems the bitter cold claimed him. Goodbye old friend. Your stage sucked.
0 0
Luigi pipiconpopo1
12/29/2016 6:28 PM
Campiña
¡Genial!
3 0
Max StarWarsGuy03
12/29/2016 6:22 PM
Plains
0 0
Craft Craft_Mesa
12/29/2016 6:05 PM
Stranded Ship
I'm sorry, my friend... you kinda deserved that.
0 0
Craft Craft_Mesa
12/29/2016 6:00 PM
Clockwork Tower
I BEAT TINKER KNIGHT WITH A FISHING ROD, THAT'S PATHETIC.
0 0
Craft Craft_Mesa
12/29/2016 5:58 PM
Clockwork Tower
You may be big and scary, but I have Godmode!
0 0
Nick CookiesKids
12/29/2016 5:53 PM
Flying Machine
So much phase locket
1 0
Craft Craft_Mesa
12/29/2016 5:35 PM
Flying Machine
This is like autoscrolling in a sonic game. it has no perpose.
0 0
Craft Craft_Mesa
12/29/2016 5:31 PM
Encounter - Black Knight
Rest in Spaghetti, never forgetti.
0 0
fire skull tudor09
12/29/2016 5:31 PM
Plains
how do u get past the bubbles
3 1
Craft Craft_Mesa
12/29/2016 5:28 PM
Iron Whale
Fire? underwater? seems legit.
0 0
Craft Craft_Mesa
12/29/2016 5:19 PM
Lost City
Ahh cheats, you let me run on lava so fast...
1 0
Craft Craft_Mesa
12/29/2016 4:36 PM
Plains
The adventure continues...
3 0
BSG-Jay Jay12827
12/29/2016 4:31 PM
Flying Machine (Plague)
I'm 200% more jubilant! And that does what exactly?
2 0
Aldrich Aldrich.exe
12/29/2016 3:34 PM
Charca Truchanzana
2 0
Jeff Jcrow323
12/29/2016 3:19 PM
Iron Whale
Iron tank
0 0
Brandon bretzb95
12/29/2016 1:50 PM
Stranded Ship
Great graphics to much water.
3 0
sky papa swenocha
12/29/2016 1:39 PM
Lost City
why did he have fire
4 0
Duchaaa Martin3211
12/29/2016 1:34 PM
Máquina Voladora
creo que devi traer otra armadura
0 0
Outlaw thonyswall
12/29/2016 1:33 PM
The Lich Yard
i defeated the boss of lich
0 0
Albi ChimaeraUltimo
12/29/2016 12:48 PM
Explodatorium
welp
0 0
william SuperDeal13
12/29/2016 12:33 PM
Village
shovel knight is awesome
1 0
steveo134 steveo134
12/29/2016 12:15 PM
Clockwork Tower
this game is the ish,ghosts n goblins meets mario!
3 0
Mercetron Mercetron
12/29/2016 11:50 AM
Pridemoor Keep
This defeat has been brought to you by... Shovel Justice!
0 0
Mercetron Mercetron
12/29/2016 11:48 AM
Pridemoor Keep
King knight talks to a mirror as he speaks. Maybe he would like that.
1 0
Sean TheFreakingWarbo
12/29/2016 9:31 AM
Lost City (Plague)
Be careful with your bombs here!
1 0
daniel danielxv7
12/29/2016 8:04 AM
Explotatorium
0 0
Carlos Armijo_Family
12/29/2016 7:12 AM
Plains
this game is old
0 0
Lee MrBrake
12/29/2016 6:42 AM
Iron Whale
i just completed the game ! and at the end he saves sheild knight
2 0
Terrell SS2-Goten
12/28/2016 10:36 PM
Encounter - Plains (Plague)
I wish the next character you use after Shovel Knight was Tinker Knight.
4 1
Craft Craft_Mesa
12/28/2016 9:02 PM
Encounter - Baz
I wish we could have Rematches with the Wandering Heroes.
5 0
Nicholas mariojr123
12/28/2016 8:55 PM
Plains
helo
1 1
Craft Craft_Mesa
12/28/2016 8:53 PM
Armor Outpost
I just saw a frog dressed up as Shovel Knight.
7 0
Mr.Perfect blakeneycain
12/28/2016 7:14 PM
Iron Whale
Wait, I one coin short!
1 0
Owen rockhead92
12/28/2016 6:58 PM
Armor Outpost
0 0
Jacob nintimmy
12/28/2016 6:53 PM
The Lich Yard
when your stuck in a puzzle (literelly) and cant get out
0 0
m michealhaynes
12/28/2016 6:13 PM
Tower of Fate: Ascent
beating the rush on new game plus
0 0
Corazon cruz2233
12/28/2016 5:54 PM
Clockwork Tower
AWW hes like a wittle penguin
2 0
Corazon cruz2233
12/28/2016 4:48 PM
The Lich Yard
Heh i let shield knight fall im a bad person rest in spaghetti never forgetti
9 0
Dani Oh_Boy_08
12/28/2016 4:38 PM
Lost City
4 0
Dani Oh_Boy_08
12/28/2016 3:54 PM
Village
4 0
Dani Oh_Boy_08
12/28/2016 3:49 PM
Village
10 0
Roduss626 Roduss626
12/28/2016 3:29 PM
Iron Whale
dia 4 jugando shovel knigth :D
2 0
Dani Oh_Boy_08
12/28/2016 3:26 PM
Iron Whale
1 0
Dani Oh_Boy_08
12/28/2016 2:46 PM
Explodatorium
2 0
Dani Oh_Boy_08
12/28/2016 2:40 PM
Explodatorium
0 0
mario creeptothecraft
12/28/2016 2:39 PM
Clockwork Tower
0 0
Dani Oh_Boy_08
12/28/2016 2:37 PM
Explodatorium
0 0
Link★16 PuunyPuff
12/28/2016 2:23 PM
Village
2 0
Jeff Jcrow323
12/28/2016 2:01 PM
Clockwork Tower
Feels like gears!
2 0
josh supersayinjosh
12/28/2016 1:48 PM
Lost City
that's just to hot
4 1
AA bluechild53
12/28/2016 1:24 PM
Plains
hel@
0 0
Romulus bhaskarb
12/28/2016 1:19 PM
Pridemoor Keep
shovel drop dude
0 0
Romulus bhaskarb
12/28/2016 1:16 PM
Pridemoor Keep
jump carefully my little peanut
0 0
Tom leonidasdecree
12/28/2016 12:52 PM
The Lich Yard
i love shovel knight
1 0
Romulus bhaskarb
12/28/2016 12:48 PM
Plains
easy
0 0
gatorman73 Alligator1
12/28/2016 11:57 AM
Pridemoor Keep
King knight more like ring knight because when I hang out with him i wish i only had 7 days to live
0 0
Maximus Maximus_Wild
12/28/2016 9:42 AM
Plains
0 0
Toñin Juantonio_1027
12/28/2016 9:34 AM
Finca de Liches
This game is so hard!!!!
1 0
ιμχяαу pipsqu33k
12/28/2016 9:14 AM
Encounter - Black Knight
Why is black knight so good?
0 0
Momii NoemHome
12/28/2016 8:59 AM
Plains
this is so haarrdd!!!!!!
3 1
humfin!!! Humfin
12/28/2016 8:17 AM
Plains
i love this game! exept for bubbles i die evrytiem
1 0
Cake MagicGuy
12/28/2016 8:17 AM
Pridemoor Keep
So far this game has been phenomenal. Love it.
2 0
Aiden MrMushroom2
12/28/2016 7:37 AM
The Lich Yard
i have no idea why this is one of the first levels...
4 1
Bel Borges tonarinoberu
12/28/2016 3:01 AM
Village (Plague)
20 0
Nate daddywithadream
12/28/2016 1:36 AM
Village
got this game a few days ago and it's pretty good thus far it was a little chageing at first though
4 0
Slick Slicknick2008
12/27/2016 9:38 PM
Lost City
Mole knight didn't stand a chance son
3 0
TB5 walinkmon-200321
12/27/2016 9:08 PM
Finca de Liches
Esta facil la pelea. SI NO FUERA AOSCURAS.
0 0
Clark ClarkJS
12/27/2016 6:42 PM
The Lich Yard
2 0
jex jwokarate
12/27/2016 6:32 PM
Explodatorium
ummmmmmmmm!
0 0
Tohloo Tohloo
12/27/2016 5:55 PM
Pridemoor Keep (Plague)
Got em
0 0
jake bigjake08
12/27/2016 5:41 PM
Plains
Started the new game plus option Easy Mode!! Enchantress Here I Come!!
3 0
Burnip EverSoTired21
12/27/2016 5:38 PM
Plains
how do u get past the part in level one with the bubbles
2 0
255 twofivefive
12/27/2016 5:34 PM
Troupple Pond
watch out for apple cores! (O-O)
1 0
255 twofivefive
12/27/2016 5:32 PM
Troupple Pond
merry x-shovelmas! i do not know what that means!
0 0
255 twofivefive
12/27/2016 5:25 PM
Pridemoor Keep
you can destroy checkpoints! i destroyed the first,second,and third checkpoints,but i die a lot. bye
3 0
255 twofivefive
12/27/2016 5:04 PM
Troupple Pond
i got a sword but it leapt away! i also found a skull?
1 0
255 twofivefive
12/27/2016 5:00 PM
The Lich Yard
1 0
255 twofivefive
12/27/2016 4:48 PM
The Lich Yard
the ghosts are comeing to my body to take it!!!!! (0_0)
3 1
Britt carsonjay1
12/27/2016 4:42 PM
The Lich Yard
lol dank maymays
1 0
Link★16 PuunyPuff
12/27/2016 3:34 PM
Plains
0 0
Duchaaa Martin3211
12/27/2016 3:25 PM
La Ciudad Perdida
2 0
loudon swords1234
12/27/2016 2:11 PM
Tower of Fate: Ascent
chicken over here
3 0
ιμχяαу pipsqu33k
12/27/2016 12:39 PM
Explodatorium
Do I have to beat this level?
2 0
Duchaaa Martin3211
12/27/2016 12:30 PM
Villa
golpear el letro fuera de donde venden comida y aumenta la maga deja caer pociones de magia
2 0
Lee MrBrake
12/27/2016 12:22 PM
Iron Whale
bytjhhhxjsmjjzkkxxh vgvcgrrvsrguruakgkn
1 0
dad hdewit001
12/27/2016 12:16 PM
Armor Outpost
Hang out at tue Armor Outpost for a while and a Shovel Knight without a helmet appears!
8 0
ιμχяαу pipsqu33k
12/27/2016 12:12 PM
Iron Whale
1 0
Nick Khurim
12/27/2016 12:07 PM
Tower of Fate: Ascent
About to head to the Boss Rush!
1 0
Nick Khurim
12/27/2016 11:58 AM
Tower of Fate: Ascent
Just got my amiibo to level 50 on the final level!
1 0
johnny lesthewise
12/27/2016 11:50 AM
The Lich Yard
super spooky hard
1 0
johnny lesthewise
12/27/2016 11:41 AM
The Lich Yard
its so hard
2 0
Josef Josef1111
12/27/2016 10:15 AM
Plains
3 0
Regina rrbarnes
12/27/2016 9:05 AM
The Lich Yard
THIS GAME IS AWSOME!!!!!!!!!!!!!
3 0
Joshy LegendofJosh1123
12/27/2016 6:44 AM
Pridemoor Keep
the king is super easy whrn you have the fire rod XD
9 0
liam liamvis
12/27/2016 6:19 AM
Village
2 0
Clam★Böne Therubyskull
12/27/2016 6:14 AM
The Lich Yard
Agreed.
5 0
Spageti maximillion03
12/26/2016 11:34 PM
Village
kachow
3 0
dad wirigendo
12/26/2016 9:55 PM
Iron Whale
0 0
dad wirigendo
12/26/2016 9:49 PM
Iron Whale
i think this level earns me the most money
0 0
bb evan bbevan17
12/26/2016 9:32 PM
Plains
2 0
Jhey JheyAlvarez
12/26/2016 9:24 PM
Finca de Liches
kiero encora la cloria
0 0
Kor:D Zombiefriend34
12/26/2016 8:56 PM
Plains
playing again!
1 0
255 twofivefive
12/26/2016 8:31 PM
The Lich Yard
....................................................................................................
1 0
William William551
12/26/2016 8:30 PM
Pridemoor Keep
wy is this buble dragon a thing, KILL IT WITH FIRE
1 0
255 twofivefive
12/26/2016 8:24 PM
The Lich Yard
0 0
255 twofivefive
12/26/2016 7:55 PM
Pridemoor Keep
hi i am just starting out! if you have the time you can help me if you want to. bye!
1 1
Joe Mallston
12/26/2016 7:27 PM
Troupple Pond
0 0
mike toxicman7
12/26/2016 5:50 PM
The Lich Yard
my god!!!!
1 0
thawk TristanHawk
12/26/2016 5:07 PM
Pridemoor Keep
ht
0 0
Jack DatGuyFromGame
12/26/2016 5:00 PM
Forest of Phasing
4 0
ιμχяαу pipsqu33k
12/26/2016 4:34 PM
Plains
Yeah
0 0
ιμχяαу pipsqu33k
12/26/2016 4:28 PM
Plains
Y do I keep dying ON THE FIRST LEVEL??
5 0
darklord12 darklord15516
12/26/2016 3:53 PM
Plains
cant figure out wich button you pressed to use a potion can somebody help?
0 0
Brian Diz-Hydron
12/26/2016 3:50 PM
Village
Orb of Chaos and Staff of Striking are OP
2 0
tako takobeast
12/26/2016 3:44 PM
Village
3 0
Dude Dude1974
12/26/2016 3:34 PM
Plains
1 0
Rena Lucy-n-Linus
12/26/2016 3:10 PM
The Lich Yard
Boss Down X3
0 0
Jeffrey JeffreyCowboy
12/26/2016 2:40 PM
Plains
So hard
1 0
Trey Peefinator55
12/26/2016 1:51 PM
Armor Outpost
when will they make more DLC to play as other characters
4 3
Will Atariuzi
12/26/2016 1:39 PM
Plains
0 0
Dad brianp215
12/26/2016 12:56 PM
Plains
THAT JUMP
0 0
finlay Finlay06
12/26/2016 5:04 AM
Pridemoor Keep
I got this for christmas and I have already beat the game. Fun exciting game i would play alot. ö
1 0
Gnoira Gnoira
12/26/2016 1:17 AM
Pridemoor Keep
Twas the night before Christmas, and in the house; one creature was stirring: a Helicopter Mouse.
14 0
alex thorxl
12/25/2016 10:19 PM
Plains
Only I
2 0
James 042380
12/25/2016 8:34 PM
Explodatorium
yeah!!!:) I finally defeated the boss of this level
0 0
Ethan efolzie13
12/25/2016 7:31 PM
Stranded Ship
1 0
Pol alav94
12/25/2016 6:06 PM
Villa (Plague)
2 0
Corbin corbisaurus-rex
12/25/2016 5:59 PM
Explodatorium
hi
2 0
Riki marioluigi0308
12/25/2016 4:48 PM
Plains
I just got this game and i beat the first boss
0 0
Engineer WarlordWailord
12/25/2016 3:44 PM
Pridemoor Keep
here's JONNY
3 0
Pikamisty Pikamisty
12/25/2016 3:25 PM
Plains
blep
1 0
choNcho choNcho2010
12/25/2016 3:08 PM
Plains
ugh black knight
0 0
Sunny SunnyXTC
12/25/2016 2:28 PM
Village
Fishing does damage, its crazy and funny!
1 0
Diego diegonetwork
12/25/2016 1:48 PM
Máquina Voladora
ahi les va una ayudita: el ancla
0 0
Nandok nandonin
12/25/2016 12:59 PM
Extra - Fortaleza del Orgullo
3 0
Cool_gamer ltyson
12/25/2016 11:31 AM
Plains
this game is so hard but epic!
1 0
Lucas 3kidsma
12/25/2016 11:29 AM
Plains
oh yes man
0 0
Lucas 3kidsma
12/25/2016 11:27 AM
Plains
i'm wii u in SHOVEL KNIGHT
2 0
Lucas 3kidsma
12/25/2016 11:24 AM
Plains
Hi
1 0
Jess munchman23
12/25/2016 10:59 AM
Explodatorium
jj
0 0
Jeff Jcrow323
12/25/2016 10:44 AM
Clockwork Tower
Shovel awesome!
2 0
Gabe Mans3030
12/25/2016 10:26 AM
Plains
ggg
1 0
S-MAN RamFam1855
12/25/2016 9:51 AM
Iron Whale
how do you use trouples
2 0
Kun SEBAS-SILVESTRE
12/25/2016 9:40 AM
Village
Merry Crhristmas fellow knights!
2 0
zxt zxt2099
12/25/2016 9:32 AM
Village
hhhhhh
1 0
Joe sbygbduvrj41843t
12/25/2016 9:30 AM
Pridemoor Keep
1 1
James JamesWM100
12/25/2016 9:02 AM
Plains
...
0 0
Samuel StacyRickman
12/25/2016 8:06 AM
Plains
what a great game!
1 0
Keanan KeananGameZ
12/25/2016 7:13 AM
Plaines
j'ai battu dark knight!
0 0
S-MAN RamFam1855
12/25/2016 7:09 AM
Pridemoor Keep
done with king knight
3 0
Clam★Böne Therubyskull
12/25/2016 6:46 AM
Village
2 0
S-MAN RamFam1855
12/25/2016 6:34 AM
Plains
0 0
Clam★Böne Therubyskull
12/25/2016 6:22 AM
Troupple Pond
I just got some Ichor of fortune.
2 0
Clam★Böne Therubyskull
12/25/2016 6:15 AM
Village
I BEAT THIS GAME ON 3DS, BUT IT'S NICE TO START GOOD AND FRESH! I like this feature.
0 0
S-MAN RamFam1855
12/25/2016 6:14 AM
Plains
black knight is hard
1 0
S-MAN RamFam1855
12/25/2016 6:01 AM
Plains
Just got the game and i love it!
3 0
chaha chacha411
12/25/2016 5:06 AM
Plains
i died so many times. so hard!
4 0
Etho Ethanology
12/24/2016 8:17 PM
Plains
i am so excited for this game
0 0
marek vulfinstine
12/24/2016 8:02 PM
Plains
suck it !!!
0 0
Osvaldo osvaldovb
12/24/2016 4:07 PM
Campiña
Gane...
0 0
Mikey DarthMikey55
12/24/2016 2:48 PM
Plains
first level down
0 0
dantdm(2) patipip
12/24/2016 2:21 PM
Pridemoor Keep
vfabdrhvadzs
2 0
The Robstr MrMooMooMooMoo
12/24/2016 1:48 PM
Explodatorium
2 0
Moon homeninnet
12/24/2016 1:10 PM
Explodatorium
The Music is SO AWESOME AND AMAZING! Also Merry Christmas, Kwanza, Hanukkah, and Happy new years!
1 0
Britt carsonjay1
12/24/2016 12:05 PM
Pridemoor Keep
frick
2 0
Loïc Giguere
12/24/2016 11:59 AM
Tour du Destin : Montée
miouw
0 0
trey newtreyman
12/24/2016 11:14 AM
Stranded Ship
my money
4 0
Jared CrazyEpicPieGuy
12/24/2016 10:31 AM
Explodatorium
oops. just destroyed the checkpoint.
2 0
k'e flerk247
12/24/2016 9:03 AM
The Lich Yard
1 0
Link_BotW5 00969a
12/24/2016 8:11 AM
Tower of Fate: ????
final... level... so ... hard!!!!
3 0
Goku SSGod cola88
12/24/2016 7:33 AM
Village
My favorite Wii U game so far until BoW
1 0
chris inkling911
12/23/2016 10:17 PM
Armor Outpost (Plague)
plague knight: i well call this villgae plague village
1 0
chris inkling911
12/23/2016 10:15 PM
Pridemoor Keep (Plague)
plague knight: i am the new king now lick my feet king knight.king knight: NOOOOOOOOOOO!
0 0
chris inkling911
12/23/2016 10:04 PM
Tower of Fate: ???? (Plague)
plague knignt: omg i beat cthulu
0 0
chris inkling911
12/23/2016 10:02 PM
Tower of Fate: ???? (Plague)
plague knight: oh boy a shadow mario knockoff
3 0
chris inkling911
12/23/2016 9:59 PM
Tower of Fate: ???? (Plague)
plague knight: if i die i must tell my sins i killed shield knight. shovel knight: PLAGUE KNIGHT!
0 0
ChronoGame floressean6
12/23/2016 7:30 PM
The Lich Yard (Plague)
I hate levels that I can't see...
6 0
PoppaTy WashDaddy
12/23/2016 5:43 PM
Troupple Pond
What is this fish doing?lol!
1 0
«Cole» neostorm04
12/23/2016 5:36 PM
Village
gotta go fast!
1 0
scarface99 scarface2099
12/23/2016 5:24 PM
Plains
uhhh
1 0
flaco mosesid123
12/23/2016 4:56 PM
The Lich Yard
3 0
Sarons grodoman
12/23/2016 4:48 PM
Tower of Fate: Ascent
~Deep in the tower is where I must go...The fate of the world is something hold.~ CONTINUE THE SONG
3 0
James turjam
12/23/2016 4:47 PM
Plains
this game sux!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
1 0
Link_BotW5 00969a
12/23/2016 4:21 PM
Iron Whale
Best rpg ever!!!
0 0
Sawyer jfarlin
12/23/2016 4:12 PM
The Lich Yard
0 0
ray rayfancyboy03
12/23/2016 3:19 PM
Tower of Fate: Ascent
Almost done with New Game +! Tower of Fate in this mode is probably the hardest challenge ive had.
0 0
Bailey C. LegendB21
12/23/2016 1:46 PM
Explodatorium
Plague Knight is wrecking me
0 1
Sergio sergiomister
12/23/2016 1:42 PM
The Lich Yard
l got shovel night for x-mas
0 0
Jared CrazyEpicPieGuy
12/23/2016 1:20 PM
Pridemoor Keep (Plague)
FINALLY!!!
3 0
Jared CrazyEpicPieGuy
12/23/2016 1:14 PM
Pridemoor Keep (Plague)
Anyone Who Thinks Plauge Knight Is Bad, (Fat Cat) SUCKS!
3 0
Jared CrazyEpicPieGuy
12/23/2016 1:11 PM
Pridemoor Keep (Plague)
I LOVE THIS GAME!!!
4 0
Kevin Cyberkevin87
12/23/2016 11:38 AM
Fortaleza del Orgullo
5 0
Andrew Inker444
12/23/2016 10:22 AM
Pridemoor Keep (Plague)
2 0
Ryan Hero_Of_HyruIe
12/23/2016 9:41 AM
Hall of Champions (Plague)
cinnamon toast ken
1 0
Ryan Hero_Of_HyruIe
12/23/2016 9:07 AM
Explodatorium (Plague)
Secret!
3 0
Batman P-Dizzle311
12/23/2016 8:07 AM
Plains
1 0
20peanut03 20peanut03
12/23/2016 7:12 AM
Troupple Pond
YEP! You can totally die here by leaping into the waters.
0 0
Temmie Locustbug
12/23/2016 6:58 AM
Stranded Ship
1 0
David Elephantboyq
12/23/2016 3:03 AM
Dagger Dash
The key, is to not die.
0 0
David Elephantboyq
12/23/2016 3:00 AM
Double Bubble
It's the worst when you accidentally pop two bubbles at once.
3 0
Gonzalo Gonzalo_Inzunza
12/23/2016 12:23 AM
Campiña
Hola !!!
1 0
James JJ_Da_B
12/22/2016 9:35 PM
The Lich Yard
wake up!
1 0
James JJ_Da_B
12/22/2016 8:39 PM
Troupple Pond
haha love this game
0 0
Nick CookiesKids
12/22/2016 7:03 PM
Iron Whale
I should sleep in!
1 0
Creeper Creeper_fan123
12/22/2016 6:32 PM
Village (Plague)
I miss you Mona! ... I hate you Black Knight!!!!
4 0
madara gascafamily
12/22/2016 6:08 PM
Plains
bean
2 1
Nick CookiesKids
12/22/2016 5:52 PM
Plains
So wierd coming back here when im OP!
2 0
Angelica JellyGeli
12/22/2016 5:44 PM
Iron Whale
stuck :)
6 0
joey chiefcool9
12/22/2016 5:15 PM
Plains
1 0
DULARICB34 david_diva
12/22/2016 5:05 PM
Village
ola!
0 0
Mustard krazytodd
12/22/2016 3:44 PM
Plains
3 0
ChronoGame floressean6
12/22/2016 2:12 PM
Clockwork Tower
I wonder what happens if you put Dr. Wily in the picture... DEATH INCINERATE!!!!
1 0
ChronoGame floressean6
12/22/2016 2:09 PM
Clockwork Tower
The only reason why I before the second part of thy battle was beacause I made it with only 1 health
2 0
ChronoGame floressean6
12/22/2016 1:44 PM
Clockwork Tower
This song is one of the best in the game! But, why does it remind me of Spark Man's Theme?
3 0
ALEX! socalemmas
12/22/2016 1:43 PM
Plains
THIS IS A GREAT GAME
5 1
Marcus3D Kightof3D
12/22/2016 1:08 PM
Iron Whale
Treasure Knight is so easy omg,
6 0
Zach zak2696
12/22/2016 11:44 AM
Plains
3 0
larl tanooki0505
12/22/2016 11:38 AM
Village (Plague)
so exited for specter of tormant
10 1
Marcus3D Kightof3D
12/22/2016 10:13 AM
Pridemoor Keep
Love this game <3
2 0
Daniel fluffuldan
12/22/2016 9:18 AM
Village
ate troupple
2 0
KoH Asugi gninja9999
12/22/2016 7:11 AM
Stranded Ship
tip use phase locket
2 0
ChronoGame floressean6
12/22/2016 7:01 AM
Stranded Ship
I have da GOLD ARMOR! OVERPOWERD!!!!
1 0
woody 3d lpbowen
12/22/2016 6:55 AM
Plains (Plague)
1 0
Torin TorinSimmons
12/22/2016 5:45 AM
Forest of Phasing
love shovel knight
2 0
Sean TheShadowBlade
12/21/2016 7:59 PM
Lost City
Mole knights level sux!!
1 0
Mustard krazytodd
12/21/2016 7:22 PM
Stranded Ship
TIP: Use Moble Gear
1 0
sans jackey05
12/21/2016 6:18 PM
Village
easy game 10/10
1 0
Welo mccruz72
12/21/2016 5:29 PM
Plains (Plague)
gonna get cash for heavy armor
0 0
B33 libcall
12/21/2016 3:48 PM
Lost City
This is one of my fave levels. The boss was kinda easy tho....
2 0
Tomi 640Tomi640
12/21/2016 3:26 PM
Campiña
Esta genial
3 1
ChronoGame floressean6
12/21/2016 12:55 PM
Stranded Ship
You did know that Polar Knight Guards the sunken remains of the Titanic right?
7 0
Sean Greenk4
12/21/2016 11:45 AM
Village
100% as Shovel Knight, Time for Plague Knight before the next DLC
3 0
DapperDW dapperdw
12/21/2016 10:43 AM
Plains
Have a merry Chistmas.
1 0
ChronoGame floressean6
12/21/2016 10:43 AM
Iron Whale
Help me mom i'm falling!
0 0
ChronoGame floressean6
12/21/2016 10:37 AM
Iron Whale
It's like the dragon battle in Mega Man 2! Good on them for that!
1 0
ChronoGame floressean6
12/21/2016 10:35 AM
Iron Whale
NOOOOOO! ANGLEBOY12345678900 HAS RISEN FROM HIS GRAVE FROM ROBLOX!!!!! STAY AWAY FROM MEEEEEEEEEEEE!
0 0
ChronoGame floressean6
12/21/2016 10:30 AM
Iron Whale
I'm getting Seasick from dying in this level! Especially since I'm in Game Mode+
1 0
ChronoGame floressean6
12/21/2016 10:17 AM
Rematch: The Baz
NO MORE FLOAT CASING!!! NO MORE FLOAT CASING!!!!!!!!!!!!!!!! *BLEEP* YOU PLAGUE AND YACHT CLUB GAMES
1 0
ChronoGame floressean6
12/21/2016 10:14 AM
Rematch: Reize
Better loadout than most of these Rematches here.
0 0
ChronoGame floressean6
12/21/2016 10:10 AM
Rematch: Treasure knight
If you ask me... I think this loadout is even worse than Specter Knight's Loadout!
0 0
ChronoGame floressean6
12/21/2016 10:07 AM
Rematch: Specter Knight
AND THAT TIME LIMIT...
1 0
ChronoGame floressean6
12/21/2016 10:05 AM
Rematch: Specter Knight
Worst weapon choice ever, Have Fun
1 0
ChronoGame floressean6
12/21/2016 10:01 AM
Rematch: The Baz
Mega Man must have asked Shovel Knight to only use a melee weapon to understand the Mega Buster!
0 0
ChronoGame floressean6
12/21/2016 9:58 AM
Cog Bounce Chaos
When I First saw this Challenge, I said "Challenge Accepted!" After I died... I said... "NOPE!"
1 0
David Elephantboyq
12/21/2016 9:48 AM
The Lich Yard
Spectre Knight is much less difficult once you obtain the throwing anchor, but still really hard.
1 0
David Elephantboyq
12/21/2016 9:44 AM
The Lich Yard
Spectre Knight is one of the most difficult bosses in this game. Only second to The Enchantress.
4 1
Diego diegonetwork
12/21/2016 8:16 AM
Campiña
mi nuevo archienemigo: las fosas >:)
0 0
ChronoGame floressean6
12/21/2016 8:10 AM
Missile Ride Mayhem
Guaranteed to trigger you bad.
0 0
Tim_1017 dark_1017
12/21/2016 7:11 AM
Pridemoor Keep
how do you use spellbook
2 0
Mustard krazytodd
12/21/2016 6:36 AM
Iron Whale (Plague)
I'm Rich!!
1 0
Ryan Grovilis
12/21/2016 3:17 AM
Tower of Fate: Ascent
Try po-going on Propeller Knight's head at the upturn of his flying swoop after he has dropped bombs
2 0
Ryan Grovilis
12/21/2016 3:10 AM
Tower of Fate: Ascent
Can't really think of anything other than green orbing em in corners and phasing to try n' get hits
0 0
Robert taydeu
12/20/2016 6:31 PM
Village
Everyday im shufflin'
2 0
Elise ShipSinker0326
12/20/2016 6:25 PM
Village
4 0
Sarons grodoman
12/20/2016 6:03 PM
Flying Machine
0 0
Pix DarthDerp2005
12/20/2016 5:59 PM
The Lich Yard (Plague)
Specter knight is horrible (at least we're getting his story soon so that's awesome)
4 0
Sarons grodoman
12/20/2016 5:41 PM
Village
0 0
Alumanite alumanite
12/20/2016 3:35 PM
The Lich Yard
lol so haaaaaaaaaaaard
0 0
Connor 366842
12/20/2016 1:57 PM
Plains (Plague)
whaaaaaaaaaaaaaaat
1 0
DarkKnight TheBarkleys
12/20/2016 12:45 PM
Plains
Vinny64 You turned on spoilers
4 0
Pix DarthDerp2005
12/20/2016 11:35 AM
Plains
safety-first!
1 0
Brody derickop
12/20/2016 6:46 AM
Stranded Ship (Plague)
I like plague knight!
1 0
Mustard krazytodd
12/20/2016 5:10 AM
Frigid Flight
0 0
Mustard krazytodd
12/20/2016 4:48 AM
Hall of Champions
0 0
Pyre Pyre_Dynasty
12/19/2016 9:40 PM
Frigid Flight
Do not go quiet into that dark night. Rage rage against the dying of the light.
0 0
gael ferminf
12/19/2016 6:36 PM
Plains (Plague)
did you see my bosses new video it is so cool
1 0
gael ferminf
12/19/2016 6:31 PM
Plains (Plague)
i would make the best dlc
3 0
Ryan DaBiscuit
12/19/2016 6:18 PM
Pridemoor Keep
*insert cdi link "I WON!"*
0 1
Callum Calimari969
12/19/2016 4:00 PM
Iron Whale (Plague)
jjsjktghhvg
1 0
HappyGamer 1HAPPYGAMER
12/19/2016 3:30 PM
Plains (Plague)
"Cheating is not the way to go as the bomb is also more powerful than a cheat"
4 0
POPFIZZ17 POPFIZZ18
12/19/2016 2:31 PM
Plains
YOURE FIRED!!! yeah i won!
0 0
Elijah UnrelentingForce
12/19/2016 2:21 PM
Armor Outpost (Plague)
You cant make croaker laugh!!
4 0
Cetega Cetega
12/19/2016 12:56 PM
Tower of Fate: Ascent (Plague)
Holy cluster powder on Mole Knight! He didn't make it past his first attempt to hide underground.
2 0
BBQ StitchesBMonster
12/19/2016 12:42 PM
Pridemoor Keep (Plague)
SPEEDRUN!!!!!
0 0
dr.elmo jakedadmom
12/19/2016 10:36 AM
Pridemoor Keep
press down rapid fast
2 0
Ryan Ryan_Rahmati
12/19/2016 8:16 AM
Armor Outpost
2 0
Gizmo heffee44
12/19/2016 8:03 AM
Pridemoor Keep
I lost all data but this did`t because cheat code TVSVOUIEO.
3 1
Cetega Cetega
12/18/2016 11:23 PM
Clockwork Tower (Plague)
Oh wow. Cluster powder indeed, particularly with the lob casing. Poor Tinker Knight.
0 0
xavier bub-40
12/18/2016 11:19 PM
Plains
0 0
[Syn] Ai ThatGuyGames
12/18/2016 10:37 PM
Lost City
This game is super easy (Its not easy at all)
7 0
Cetega Cetega
12/18/2016 10:13 PM
Lost City (Plague)
I really feel like some sections of this are actually easier with Plague Knight's awesome mobility.
2 0
Cetega Cetega
12/18/2016 9:50 PM
Troupple Pond (Plague)
I will absolutely never tire of this.
4 0
Nick Nicholas_Hen
12/18/2016 8:39 PM
Stranded Ship
Great Game :D Love it, Gotta Grump
4 0
scott Sonic_The_Cat
12/18/2016 8:07 PM
Tower of Fate: Entrance (Plague)
i swear. just put a checkpoint here closertowhere i die
2 0
dalton shrtcake1222
12/18/2016 7:08 PM
Troupple Pond
trople kings dance is so cool
2 0
alexis chaoticninja1
12/18/2016 6:24 PM
Hall of Champions
hi
2 0
David Elephantboyq
12/18/2016 6:17 PM
Tower of Fate: Entrance
Does money really even matter when you're this far into the game?
0 0
David Elephantboyq
12/18/2016 6:13 PM
Tower of Fate: Entrance
This level is amazing!
1 0
dalton shrtcake1222
12/18/2016 6:06 PM
The Lich Yard
nice i love this game
1 0
TonicSonic SonicAlek
12/18/2016 5:06 PM
Plains
3 0
dr.elmo jakedadmom
12/18/2016 5:00 PM
The Lich Yard
I finally defeated king knight!
3 0
angus erwinandson
12/18/2016 4:40 PM
Troupple Pond (Plague)
speter torment is a new d.l.c thats coming out the traler looks good !!!!! ;-D
6 0
angus erwinandson
12/18/2016 4:35 PM
Troupple Pond (Plague)
what does the golden hoody do ???
3 1
dalton shrtcake1222
12/18/2016 4:20 PM
Pridemoor Keep
i beat king night
0 0
Griffin Psyc0Donut
12/18/2016 3:32 PM
Pridemoor Keep
A haiku. O thy Shovel Knight. Why must you make so much puns? They are found in SPADES.
2 0
Blue THECOOLGUIES
12/18/2016 3:21 PM
Armor Outpost
there is a boss here and FIGHT HIM! YOU GET 6000 GOLD!!!
5 1
Jess FoxeeRoxeeh
12/18/2016 3:16 PM
Explodatorium
mew
0 0
LuckyKon luckykon
12/18/2016 1:57 PM
Village
Im digging this game.
2 0
sebastian sebastianht
12/18/2016 12:13 PM
Plains
i just started this game!
1 0
k'e flerk247
12/18/2016 10:58 AM
Flying Machine (Plague)
1 0
Blue THECOOLGUIES
12/18/2016 9:00 AM
Tower of Fate: Ascent
hint:the kunckle dusters are your best friend here
0 0
Jose DanteCR
12/18/2016 8:09 AM
Village
2 0
Curtis curtissikora
12/18/2016 7:06 AM
Stranded Ship
1 0
gael ferminf
12/17/2016 8:58 PM
Village (Plague)
beat fly boy
1 0
daboy DaBoy2
12/17/2016 8:39 PM
Plains (Plague)
boss #1: dead
0 0
daboy DaBoy2
12/17/2016 8:25 PM
Village (Plague)
im on new game + with god mode
1 0
David Elephantboyq
12/17/2016 8:23 PM
Troupple Pond
All hail the Trouple King!
3 0
Ryan Ryan_Rahmati
12/17/2016 6:27 PM
Lost City
doing a 3 week christmas break challenge!!
0 0
Jeannie epicpokemaniac
12/17/2016 5:46 PM
Tower of Fate: ????
ALMOST got her my first try! Remember, her projectiles can be reflected!
3 0
scott dels72
12/17/2016 5:45 PM
Flying Machine
I am a beast!!!!!
6 0
Jeannie epicpokemaniac
12/17/2016 5:39 PM
Tower of Fate: ????
Hi, friend!
2 0
Jeannie epicpokemaniac
12/17/2016 5:14 PM
Tower of Fate: Ascent
This is actually one of my favorite boss rushes ever!
2 0
Jeannie epicpokemaniac
12/17/2016 4:45 PM
Tower of Fate: Ascent
I've heard tales of this level...*gulp*
2 0
realface FamilyKaton
12/17/2016 3:12 PM
Clockwork Tower
Pipsnoplipkorp
2 0
jacksonian emmycatiscute
12/17/2016 3:02 PM
The Lich Yard
0 0
jacksonian emmycatiscute
12/17/2016 2:59 PM
The Lich Yard
This game ROCKS
0 0
boss zaydani
12/17/2016 2:02 PM
Pridemoor Keep
i found you die
1 0
3-D levk360
12/17/2016 1:56 PM
Finca de Liches (Plague)
2 0
owen thegoldencat
12/17/2016 12:18 PM
Flying Machine
fighting right now wish me luck
2 0
Blue THECOOLGUIES
12/17/2016 12:00 PM
Hall of Champions
AND WE ARE THE GAME GRUMPS!
3 0
Blue THECOOLGUIES
12/17/2016 11:48 AM
Tower of Fate: Entrance
BLACK KNIGHT HAS GONE SUPER SAIYAN!!!
2 0
Maxence Maxchoco
12/17/2016 10:50 AM
Plaines (Plague)
bahahahaha pouce verbleu
0 0
Trey TMman1
12/17/2016 10:11 AM
Explodatorium
Cleared the first area! On to Plague Knight.
1 0
gael ferminf
12/17/2016 9:30 AM
Lost City (Plague)
that mole knight needs to lay of the food because he does not walk fast
0 0
Trey TMman1
12/17/2016 9:10 AM
Plains
Playing this game again for the 16th time, but this time on the Wii U! Steel thy Shovel!
4 0
gael ferminf
12/17/2016 8:23 AM
Village (Plague)
finally beat that creep night but it is not me made it is
1 0
Robert taydeu
12/17/2016 4:53 AM
The Lich Yard
This stage though, is hard. the only reason i kept playing is cuz of the music :P
5 0
Pumpkin CarLaur99
12/16/2016 8:29 PM
Pridemoor Keep
love it but where is my fire wand. didnt save on amiibo grr!
0 0
thicc reedtommyemmett
12/16/2016 7:02 PM
Plains
don't dig-jump
2 0
Mustard krazytodd
12/16/2016 6:40 PM
Lost City (Plague)
tip: use float case
1 0
Mustard krazytodd
12/16/2016 6:34 PM
Lost City (Plague)
ride on my beetle... ride on...
2 0
Robert taydeu
12/16/2016 6:26 PM
Plains
Just got the game, so fun!
1 0
mb AM2-GPK
12/16/2016 6:17 PM
Pridemoor Keep
get reckson!!!!
3 0
roc rockhollywood79
12/16/2016 6:15 PM
The Lich Yard
1 0
Mustard krazytodd
12/16/2016 6:14 PM
Lost City (Plague)
1 0
Mustard krazytodd
12/16/2016 5:56 PM
Troupple Pond (Plague)
1 0
OPAL QuintanaPlaceNW
12/16/2016 5:55 PM
Pridemoor Keep
1 0
3-D levk360
12/16/2016 5:50 PM
Torre del Hado: Ascensión
0 0
Mustard krazytodd
12/16/2016 5:50 PM
Cog Bounce Chaos
all right, it is time to BOUNCE off some ideas.
0 0
BadWolf Papa1818
12/16/2016 5:50 PM
Tower of Fate: Entrance (Plague)
Don't bother with the book, use a vat.
2 0
Kenny iDragonBorn
12/16/2016 5:23 PM
Tower of Fate: Entrance
1 0
Tyler7361 Oklahoma11
12/16/2016 4:08 PM
Plains
Just playing on acount with internet.already beat da game!lol!!!
1 0
Scott Bearcatman
12/16/2016 3:48 PM
Lost City
2 0
jr Gazer76
12/16/2016 3:00 PM
The Lich Yard
i died and have to go all the way back to the end......damn
1 0
noobslayer noobslayerz
12/16/2016 2:27 PM
Plains
im dead lol
9 0
Android Android1215
12/16/2016 1:23 PM
Plains
I love shovel knight
2 0
X LordX19
12/16/2016 5:42 AM
Tower of Fate: ???? (Plague)
Lets go Boss time...
3 0
X LordX19
12/15/2016 8:44 PM
Tower of Fate: Entrance (Plague)
Easy! Ya done SON!!!!!!
0 0
X LordX19
12/15/2016 8:22 PM
Flying Machine (Plague)
Spam Big Boom and use: Lob casing, cluster powder, and long fuse
1 0
X LordX19
12/15/2016 8:18 PM
Flying Machine (Plague)
Finally! Made it to the Boss!!!!
1 0
Andrej zbddbz
12/15/2016 6:36 PM
Plains
Dig that bonfire BOI
0 0
BadWolf Papa1818
12/15/2016 6:22 PM
Flying Machine (Plague)
Thanks a ton, vats!
1 0
Fawful Tbone-bomber
12/15/2016 5:45 PM
Lost City
huh that was alarming easy
0 0
ChronoGame floressean6
12/15/2016 5:02 PM
The Lich Yard
FOR GOD'S SAKE!!! I CAN'T SEE IN THIS PART, AND ONLY TWO CHECK POINTS IN GAMEMODE+ IN THIS STAGE
0 0
Owen rockhead92
12/15/2016 3:52 PM
Armor Outpost
2 0
jasper momjabbar
12/15/2016 2:46 PM
Stranded Ship
1 0
jasper momjabbar
12/15/2016 2:42 PM
Stranded Ship
i deid and went to get my gold took damige and fell and on spiks i lest i got that gold i die spon
4 0
OCTOSAMERY Spiderboy207
12/15/2016 2:16 PM
Troupple Pond
what that posta mean?!
0 0
princess dragon45600
12/15/2016 2:11 PM
The Lich Yard
oscarYO
1 0
Thomas 3rd Thomas6800
12/15/2016 9:24 AM
Tower of Fate: Ascent
Be Warned: What is beyond this checkpoint will drive you insane! Good Luck!
3 0
chase luffy264
12/15/2016 5:46 AM
Lost City (Plague)
so hard! why mole knight why?!?
2 0
Peter G. jacklehunter
12/14/2016 8:21 PM
Explodatorium
Pink Armor and New Game Plus is Good Here
1 0
nik doctornik
12/14/2016 8:00 PM
Troupple Pond
don't let the fish eat you
2 0
Oscar;v leftstricker
12/14/2016 7:15 PM
Torre Mecánica
So megaman
0 0
Pedrofire sanchezpedro228
12/14/2016 4:28 PM
Campiña
Primera vez jugando
5 0
Aiden Themissinglink01
12/14/2016 4:26 PM
Plains (Plague)
Such a fun opening stage
1 0
m4xb0t xghostx103
12/14/2016 12:11 PM
Iron Whale
ALMOST AT THE END!!!!!!?!!!!!!!!!!!
0 0
Juan ColourShock
12/14/2016 7:18 AM
Troupple Pond
1 0
King Easy IsayaShabazz
12/13/2016 5:08 PM
Plains
best game in my life
2 0
hayden illambtsp
12/13/2016 4:35 PM
Village
where do you find the mythical ichor
0 1
Anderson.A Mario128x64
12/13/2016 11:30 AM
Village
Uh...are you being sarcastic or serious?
1 0
Barry TheKaine
12/13/2016 7:39 AM
Pridemoor Keep
Can't believe I actually died to King Knight...
0 0
Oscar;v leftstricker
12/12/2016 10:10 PM
Encuentro - Baz
A thought one indeed
0 0
Oscar;v leftstricker
12/12/2016 9:11 PM
Finca de Liches
EZ
0 0
Oscar;v leftstricker
12/12/2016 8:44 PM
Charca Truchanzana
this guy is hilarious
5 0
hayden illambtsp
12/12/2016 8:30 PM
Iron Whale
I did it !!!!!!!!!!!!!!!!!!
0 0
hayden illambtsp
12/12/2016 7:54 PM
Explodatorium
I did it !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
0 0
hayden illambtsp
12/12/2016 7:50 PM
Explodatorium
give me advice please on the boss
0 2
Oscar;v leftstricker
12/12/2016 7:37 PM
Villa
So awesome!!!
0 0
gabo gamerprocr2016
12/12/2016 7:34 PM
Tower of Fate: Entrance (Plague)
i am a cool plague oh yeah haha
2 0
Oscar;v leftstricker
12/12/2016 7:11 PM
Fortaleza del Orgullo
Money isn't infinite, you now?
0 0
Oscar;v leftstricker
12/12/2016 7:02 PM
Fortaleza del Orgullo
Done!
0 0
Oscar;v leftstricker
12/12/2016 6:40 PM
Villa
This game is looking good!
0 0
Golden CaterpieisLife
12/12/2016 5:51 PM
Plains
1 0
gabo gabrielara
12/12/2016 4:58 PM
Village
ya lo pase es muy bueno
5 0
felipe luislopesrosa
12/12/2016 4:16 PM
Village
terminei a po!@# do jogo
2 0
BBQ StitchesBMonster
12/12/2016 11:28 AM
The Lich Yard
OH MY GOD FINALY ALL HAIL THE TROUFLE KING!
0 0
ray rayfancyboy03
12/12/2016 10:43 AM
Plains (Plague)
Finally! I beat Shovel Knight! -Sees Plague of Shadows- Welp, here we go again! :p
1 0
Fawful Tbone-bomber
12/12/2016 9:01 AM
Armor Outpost
Bruh. RIPOFF ARTIST!
0 0
Fawful Tbone-bomber
12/12/2016 8:56 AM
Encounter - Reize
I DIDN'T KILL ANY INNOCENT PEOPLE ALL I DID WAS SLAY THE ORDER OF NO QUARTER
0 0
Fawful Tbone-bomber
12/12/2016 8:52 AM
Explodatorium
well that fight was anticlimactic.
0 0
Fawful Tbone-bomber
12/12/2016 8:39 AM
Knuckler's Quarry
Wall in ur way punch it.enemy trying 2 stop u punch him.punching not wroking.U know u punch it more
1 0
Fawful Tbone-bomber
12/12/2016 8:27 AM
The Lich Yard
I'LL SAVE YOU!! IT'S MY RESPONSIBILITY! WITH GREAT POWER COMES GERAT RESPONSIBILETEH
4 0
Fawful Tbone-bomber
12/12/2016 8:24 AM
The Lich Yard
I just murdered the grimreaper. Does that mean i'm imortal?
0 0
Fawful Tbone-bomber
12/12/2016 8:22 AM
The Lich Yard
K.O! I JUST KILLED DEATH TAKE THAT GOD! IMORTALITY IS MINE
1 0
Fawful Tbone-bomber
12/12/2016 8:18 AM
The Lich Yard
Am I the only one who sees dire consequences for killing death himself.
1 0
Fawful Tbone-bomber
12/12/2016 7:54 AM
The Lich Yard
hmm i jump on that skeleton and his head fell off... KEEP AWAY (skull breaks) oooh sheee oooh.
0 0
erikson ebrarikaham
12/11/2016 10:05 PM
Fortaleza del Orgullo
ayuda
3 0
Adrián AdrianCardena
12/11/2016 7:18 PM
Campiña
Empezando...
5 0
Jaden jadenator123
12/11/2016 7:02 PM
Clockwork Tower
The Red Baron has got to the second point in Tinker Tower
1 0
Spunky backtothedraw
12/11/2016 5:43 PM
Pridemoor Keep (Plague)
0 0
higinathor JusticeNUGGET1
12/11/2016 5:31 PM
The Lich Yard
When there's something strange in your neighborhood, who ya gonna call? SHOVEL KNIGHT
0 0
higinathor JusticeNUGGET1
12/11/2016 5:26 PM
Pridemoor Keep
0 0
deadmeow howardhuge
12/11/2016 4:35 PM
The Lich Yard
This stage tho.
4 0
Pots Solyr1
12/11/2016 4:16 PM
The Lich Yard
i dont like the specter night one. to hard
1 0
Pots Solyr1
12/11/2016 4:11 PM
Pridemoor Keep
you have to hop on them and i also do not like the spellbooks
0 0
Brian BuilderBrian
12/11/2016 4:09 PM
Pridemoor Keep
0 0
Brian BuilderBrian
12/11/2016 4:07 PM
Pridemoor Keep
1 0
Jaden jadenator123
12/11/2016 3:30 PM
Clockwork Tower
INFINIDAGGER AT LEVEL 46. NOW I CAN YELL INFINIDAGGER WHENI USE IT. GameGrumps are the best
5 0
daniel danielhl
12/11/2016 3:01 PM
Ladder Leaper
i`m getting mario maker flash backs
3 0
Steph catdumpling
12/11/2016 2:52 PM
Explodatorium
this game is on a whole new level of frickery
2 0
Jaden jadenator123
12/11/2016 2:32 PM
Armor Outpost
Still don't have the Infinidagger. So I can't yell INFINIDAGGER. Gamegrumps
8 0
Evan Toth EvanToth
12/11/2016 1:18 PM
Explodatorium
Impossible
2 0
Vinny64 Vman75
12/11/2016 12:29 PM
Armor Outpost
5 0
Vinny64 Vman75
12/11/2016 12:24 PM
Iron Whale
9 0
Bomb-man SuperSmashWIIUDS
12/11/2016 10:55 AM
Lost City
2 player mode is difficult when the second player doesn't know how to play.
3 0
gael ferminf
12/11/2016 10:15 AM
Pridemoor Keep (Plague)
i hate my boss
3 0
gael ferminf
12/11/2016 9:53 AM
Village (Plague)
im so like evil
2 0
hayden illambtsp
12/11/2016 9:45 AM
Plains
just got it
1 0
maxwell swagbro20
12/11/2016 8:29 AM
Troupple Pond
I met trouple king and he spit in my cup
4 0
BayMax shadowcow39
12/11/2016 6:05 AM
Plains
This is so retro
0 0
Terravin SuperSonicMC-YT
12/11/2016 3:59 AM
Iron Whale
I really hate water levels...
6 1
Jacob Tardis_95
12/10/2016 11:26 PM
Plains
2 0
millymoody beatsonic25
12/10/2016 9:03 PM
Plains
on the 3DS version
0 0
millymoody beatsonic25
12/10/2016 9:00 PM
Plains
i love shovel knight
2 0
Cameron Cameron_Almy
12/10/2016 8:56 PM
Troupple Pond
i ment the king
0 0
Jeezuskid Jeezuskid
12/10/2016 8:42 PM
Plains
new game. heard good things. i think im addicted...
2 0
felipe luislopesrosa
12/10/2016 6:44 PM
Troupple Pond
esse jogo e bem difícil
2 0
Vinny64 Vman75
12/10/2016 6:07 PM
Explodatorium
3 0
Vinny64 Vman75
12/10/2016 5:56 PM
Troupple Pond
0 0
Panico pabl0b
12/10/2016 5:54 PM
Torre Mecánica
I can't wait fo specter of torment!!!
0 0
Vinny64 Vman75
12/10/2016 5:49 PM
Village
4 0
Vinny64 Vman75
12/10/2016 5:40 PM
The Lich Yard
0 1
Gage GAGESTAR1414
12/10/2016 5:04 PM
Iron Whale
2 0
Vinny64 Vman75
12/10/2016 5:03 PM
Pridemoor Keep
4 0
Vinny64 Vman75
12/10/2016 4:56 PM
Plains
4 0
S. RARA jamiswil001
12/10/2016 4:45 PM
Village
sup i ate a narwal
4 0
X LordX19
12/10/2016 4:39 PM
Tower of Fate: ????
Here we go, the final boss
2 0
Meatball Meatball0708
12/10/2016 3:46 PM
The Lich Yard
i keep dying...
4 1
дгж Medin_Trolls_You
12/10/2016 12:12 PM
Plains
So far i'm doing good
0 0
Jeannie epicpokemaniac
12/10/2016 12:10 PM
Stranded Ship
The room before was a nightmare to get through!
1 0
Jaden jadenator123
12/10/2016 10:49 AM
The Lich Yard
Custom Knight Playthrough, Specter Knight Defeated
0 0
Davman Davman8
12/10/2016 10:16 AM
Stranded Ship (Plague)
If you have been trading with Chester use the potion platforms.
4 0
Celeste Celestelara2000
12/10/2016 8:43 AM
Tower of Fate: Ascent
lovin this game!!
0 0
Jeannie epicpokemaniac
12/10/2016 8:20 AM
Encounter - Baz
Man, Baz puts up a good fight! Better than that pansy, King Knight, that's for sure!
12 0
Davman Davman8
12/10/2016 7:50 AM
Iron Whale (Plague)
This game is an amazing bargain. 2 campaigns with a third and fourth coming soon.
2 0
Luke Luketheduke2002
12/10/2016 7:16 AM
Flying Machine
FOR SHOVELRY!
1 0
Ferris darktyrano
12/09/2016 11:30 PM
Fortaleza del Orgullo
2 0
TYSON kevinhartsheight
12/09/2016 11:13 PM
Lost City
0 0
TYSON kevinhartsheight
12/09/2016 11:12 PM
Lost City
0 0
Siegfried Siegfried_David
12/09/2016 10:20 PM
Torre Mecánica
solo tienes que mantenerte en su hombro y aprenderte el patron de los misiles
0 0
Jeannie epicpokemaniac
12/09/2016 6:46 PM
The Lich Yard
Fun fact! "La Danse Macabre" (The name of the song) translates as "The Spooky Dance"
5 0
Mr.DaNkMeM theminigamer
12/09/2016 4:52 PM
The Lich Yard
OMG i soo not regret geting this game its soo fun
0 0
Marco5 Beatzy
12/09/2016 4:44 PM
Tower of Fate: Ascent (Plague)
I'm so mad right now
1 0
Micah Mr.SlenderPet29
12/09/2016 3:54 PM
Tower of Fate: ????
If you see this message... Congratulations! You've officially beaten "Shovel Knight"! :D
0 0
Chicken papacasa
12/09/2016 3:14 PM
Tower of Fate: Entrance
NSMB Wii flashbacks.
1 0
Joey JoeyMcL
12/09/2016 12:57 PM
Village
I sense the spaded gold digger, but once I fight him, he shall dig the fact that I am far superior.
4 0
Max Greatforest0201
12/08/2016 10:13 PM
Dirt Clod Dive
2 0
Zachary ToxicChozo
12/08/2016 8:55 PM
Village (Plague)
Does anyone know how to find Plague Knight's secret room?
5 2
Kirtains kirtains
12/08/2016 8:42 PM
Plains
love it!!
1 0
Davman Davman8
12/08/2016 8:20 PM
Explodatorium (Plague)
That was the hardest thing ever
3 0
AluGia Alugia
12/08/2016 7:25 PM
Finca de Liches
2 0
jimmy jbowman091600
12/08/2016 6:50 PM
Troupple Pond (Plague)
plague knight dlc worth it
4 0
Iwoomynati Sniches501
12/08/2016 6:39 PM
Explodatorium
HWAAAAAAAA
1 0
Iwoomynati Sniches501
12/08/2016 6:10 PM
Lost City
Easy-peasy
1 0
camilo camilo2310
12/08/2016 5:59 PM
Frigid Flight
aaaa
7 0
Richi joserhose
12/08/2016 5:06 PM
Plains
im soooo goood
0 0
charlie charlieman03
12/08/2016 2:21 PM
Clockwork Tower (Plague)
i finally rage quited back to plague of shadows...
1 0
charlie charlieman03
12/08/2016 1:48 PM
Explodatorium
i hate these !#@#%@#%**^$^*_#$&&~#^&(cant say actual word) exploding rats!
1 0
Kyler Bears4ever
12/08/2016 1:03 PM
Plains
im on hard mode!!
0 0
Riddie riddies
12/07/2016 10:27 PM
Stranded Ship
1 0
Micah Mr.SlenderPet29
12/07/2016 6:36 PM
Explodatorium
Meat, man.
2 0
son msaunders88
12/07/2016 2:07 PM
Explodatorium
2 0
ian ianbob13
12/07/2016 12:48 PM
Troupple Pond
about to fight final boss!
0 0
Evanator Evanator13
12/07/2016 7:57 AM
Village (Plague)
let's just pretend i don't recognize you and you go safely on your merry way. why you profiling man?
3 0
charlie charlieman03
12/06/2016 5:56 PM
The Lich Yard
I maxed out my amiibo level to OVER 9000! if you got this reference, reward yourself with 5 points.
0 0
ultra wolf ultrawolf1234
12/06/2016 5:41 PM
Explodatorium
lol mages right
1 0
Jackson M Whosinwhatsit25
12/06/2016 1:10 PM
Village
0 0
Jackson M Whosinwhatsit25
12/06/2016 1:08 PM
Village
NOOOOOOO THIS BOSS GUY HAD ONE HIT THEN BECAME NOTHING AND SHOT STUFF AT ME
1 0
flavia flaviascaletta
12/05/2016 10:26 PM
The Lich Yard
cuidado com o sapo
0 0
Sats theuniquesats
12/05/2016 6:05 PM
Villa
súper fantástico!
0 0
Braxton smallzall
12/05/2016 5:43 PM
Pridemoor Keep
Knave!
1 0
Harrison jhunse
12/05/2016 5:20 PM
The Lich Yard
0 0
tio-v kobalt92
12/05/2016 2:11 PM
Plains
0 0
jake JacobHubb1983
12/05/2016 1:09 PM
Pridemoor Keep
what do i do on the spellbooks?!
1 0
Wade platinumwade
12/05/2016 8:54 AM
Village
buy the chaos orb in town as your first item it is super helpfull!!!!!
9 0
Wade platinumwade
12/05/2016 8:50 AM
Plains
press f to pay respects for that skeleton who walks off the cliff
0 0
Wade platinumwade
12/05/2016 8:43 AM
Plains
who else is excited for spectre knight dlc!
1 0
Urvy Urvy1A
12/04/2016 9:13 PM
Pridemoor Keep
0 0
Arturo Arturock09
12/04/2016 6:24 PM
Campiña
yeei
0 0
Otto NinjaPearlPanda
12/04/2016 3:22 PM
The Lich Yard
0 0
lisa badgas666
12/04/2016 3:16 PM
Village
this game rules. thanks lisa!!!!!
1 0
Bran Brandon1985
12/04/2016 2:59 PM
Village
Been playing with friends one of the best games ever made!!!
1 0
Otto NinjaPearlPanda
12/04/2016 2:30 PM
The Lich Yard
3 0
Cormac NovaWeilder98
12/04/2016 2:15 PM
Iron Whale
I suck at this
4 0
Eduardo V3N0M2003
12/04/2016 2:10 PM
Plains
Infinidagger!
3 0
Jake JakeDaPug
12/04/2016 2:07 PM
The Lich Yard (Plague)
So easy! (not)
1 0
Sydney TheSydsterEBS
12/04/2016 1:40 PM
Plains
I DONT KNOW HOW TO GET PAST THIS... THERE IS NO EXIT!!!
1 0
... alex5599
12/04/2016 12:20 PM
Explodatorium
this game makes me triggered sometimes
4 0
Niko Nbkoy24
12/04/2016 11:26 AM
Clockwork Tower
Tinker knight defeated!
0 0
k.k cloey9311
12/04/2016 9:51 AM
Troupple Pond
0 0
Kaden ahayes202
12/04/2016 9:34 AM
Troupple Pond
the legend is true!
1 0
norman Tacobusiscool
12/04/2016 9:17 AM
Explodatorium
its hard being big
2 0
vortex mattieren
12/04/2016 9:17 AM
Clockwork Tower
best game ever go butt butt
1 0
Evan Dragoncrafter456
12/04/2016 8:08 AM
Rematch: Specter Knight
oh man! i just love spectre knight's animation!!!
3 0
Evan Dragoncrafter456
12/04/2016 7:33 AM
Iron Whale (Plague)
ewwwwwww!!!!! those things creep me out!
3 0
Evan Dragoncrafter456
12/04/2016 6:55 AM
Explodatorium (Plague)
arrrgh!!! i keep dying on this part! it's so frustrating!!!
3 0
James turjam
12/04/2016 6:53 AM
Plains
3 0
camilo camilo2310
12/04/2016 6:22 AM
Plains
0 0
Alessandro Lit_Flame_of_Ice
12/03/2016 9:41 PM
The Lich Yard
I like to play with my Pogo stick on the gravestones.
1 0
Jack Fatality14
12/03/2016 9:19 PM
The Lich Yard
This level has a massive difficulty spike
1 0
Christina MrsKerwin
12/03/2016 8:14 PM
Plains
intereting game
2 3
Parker GoobiShlooby
12/03/2016 7:59 PM
Armor Outpost
i knew that triangle ob his chest reminded me of something
1 0
Journey pactty6
12/03/2016 6:01 PM
Tower of Fate: ????
4 0
Chaz chaz27
12/03/2016 5:48 PM
Lost City
2 0
Urvy Urvy1A
12/03/2016 5:34 PM
Plains
Needs marshmallows...
0 0
Kenji Dainodaibouken
12/03/2016 2:08 PM
Tower of Fate: ???? (Plague)
....¡¡¡
0 0
dad BrotherJesse
12/03/2016 1:40 PM
Tower of Fate: ????
HELP ME!!!!!
8 0
Isaiah xx kingpamda
12/03/2016 1:32 PM
Iron Whale
my amibo level fifty
3 0
Jackson M Whosinwhatsit25
12/03/2016 1:28 PM
Village
wow this game is so fun
3 0
Fuzzy bear SounderSounder
12/03/2016 12:48 PM
Explodatorium (Plague)
Will the boss of the explodatorium be shovel knight? After all, there's an intruder afoot...
6 1
Ray Coon slt750
12/03/2016 12:45 PM
Iron Whale
2 0
Fuzzy bear SounderSounder
12/03/2016 12:36 PM
Village (Plague)
I wonder who the explodatorium boss will be- I'm playing as plague knight...
3 1
Ray Coon slt750
12/03/2016 12:16 PM
Iron Whale
Shovel Knight rules :)
1 0
Robby SonicFreddy1
12/03/2016 11:36 AM
Plains
1 0
Lalo melvinzoro25
12/03/2016 10:11 AM
Fortaleza del Orgullo
1 0
Ryan Grovilis
12/03/2016 9:55 AM
Flying Machine
We can make it, you and I.
1 0
Eevee 1-up SuperTanuki
12/03/2016 9:55 AM
Village
i can't believe that mona and plague knight are in love. it feels so wierd
1 0
Hunter HunterP04
12/03/2016 9:38 AM
Iron Whale
made it through the forest of phasing without using the phase locket.
4 0
Aiden BRUDDAH
12/03/2016 9:36 AM
Plains
we defeated her
2 0
Angel angelthefirst-06
12/03/2016 9:09 AM
Plains
best game ever!!!
1 0
Anakin celo02jan07
12/03/2016 9:00 AM
Armor Outpost
I beat all the treavelers!
0 0
Anakin celo02jan07
12/03/2016 8:59 AM
Armor Outpost
I wasted all my money on a gold useless golden chestplate!
3 0
Anakin celo02jan07
12/03/2016 8:48 AM
Tower of Fate: Entrance
I made it to the first check point!
2 0
Wy_Flash wy_flash
12/03/2016 7:31 AM
Tower of Fate: Entrance
I HATE THOSE FLYING FAIRY THINGS!!!
0 0
avery alsZOMBIEboy
12/03/2016 6:37 AM
Plains (Plague)
1 0
CrayA LordLeinad
12/03/2016 6:20 AM
Forest of Phasing
3 0
τε⇒ ΐςααс zactrak
12/03/2016 6:16 AM
Tower of Fate: Ascent (Plague)
4 1
BearHoodie BearHoodie
12/02/2016 11:57 PM
Plains
Fk I died
1 0
matt matt123089
12/02/2016 9:07 PM
Plains
0 0
William 626betsy
12/02/2016 8:34 PM
Tower of Fate: ????
Well... This is it. Tell all my friends back home that I'll miss them. (sob)
4 0
William 626betsy
12/02/2016 8:30 PM
Tower of Fate: ????
2 0
Pop-Tart luigilover2.0
12/02/2016 8:06 PM
Flying Machine
IM GOING INSANE
2 0
Xavier L Trollintoad101
12/02/2016 7:08 PM
Pridemoor Keep
0 0
Xavier L Trollintoad101
12/02/2016 6:59 PM
Pridemoor Keep
2 0
Shadow ShadowCody
12/02/2016 5:35 PM
Pridemoor Keep (Plague)
dont mess with me!
0 0
Ulises Beaman138
12/02/2016 5:33 PM
Village
Spagghetti
2 0
tj andrewrice
12/02/2016 5:22 PM
Plains
This game is awsome but my dad messed the game up now I'm trying to fix it
1 1
James turjam
12/02/2016 4:01 PM
Pridemoor Keep
0 0
James turjam
12/02/2016 3:55 PM
Pridemoor Keep
2 0
Shade yanoresa
12/02/2016 3:30 PM
The Lich Yard (Plague)
cant wait till specter of torment!
3 0
Geno GenoDeRosa
12/01/2016 4:04 PM
Plains
Played dis level with an nes classic controller.
0 0
Lynkono Lynkono
12/01/2016 3:44 PM
Anchors Aweigh
Shovel Knight Co.™ Pest Control at your service.
4 0
EseNegro ArturoReyna
12/01/2016 1:36 PM
Ballena de Hierro
papitaa
0 0
Alex mgzxyolo
12/01/2016 1:07 PM
Village
1 0
Edgar chinguilingui
12/01/2016 6:18 AM
Campiña
derrote a Black Knight
4 0
Edgar chinguilingui
12/01/2016 6:15 AM
Campiña
a este tipo casi lo atrapo
2 0
Edgar chinguilingui
12/01/2016 6:11 AM
Campiña
Me encanta el además es muy llamativo por tener una pala en vez de espada
0 0
Rocket Warghet
11/30/2016 8:21 PM
Campiña
esta fino el juego
2 0
**** neverenderman
11/30/2016 7:01 PM
Village
0 0
John Kellyfam73772
11/30/2016 5:23 PM
Flying Machine
I love shovel knight
6 1
L.F-SSJ 3 Luigi300p
11/30/2016 2:28 PM
Finca de Liches (Plague)
3 0
dr.elmo jakedadmom
11/30/2016 1:55 PM
Plains
once apon a time there was knight avenger and some masters detroyed the land he saved the day
0 0
dr.elmo jakedadmom
11/30/2016 1:51 PM
Plains
Hey here is a joke does shovel knight dance and so crazy he goes ding ding wattle wattle!Do that!
3 0
Zuchuato ezenteno
11/30/2016 10:51 AM
Stranded Ship
Finally!!!!
0 0
Zuchuato ezenteno
11/30/2016 10:10 AM
Stranded Ship
Trying to pass this level
0 0
Júlio Ultimateplayg
11/30/2016 8:40 AM
Lost City
gg ez duck
0 0
LEVI everytimeilev406
11/29/2016 7:31 PM
The Lich Yard
new shovel!
5 2
Hunter turtlesarebae
11/29/2016 7:09 PM
Tower of Fate: Ascent
0 0
Kimmie Butterfly0130
11/29/2016 5:46 PM
The Lich Yard
3 0
Kimmie Butterfly0130
11/29/2016 5:42 PM
The Lich Yard
on the shovel king, allways bounce on him.
1 0
x-crow cadenmonsterpie
11/29/2016 4:11 PM
Pridemoor Keep
1 0
sawdgfuqip matthew4692
11/29/2016 3:18 PM
Explodatorium
this is the easiest game ever
0 0
A Visigoth Monky_the_second
11/29/2016 2:28 PM
Explodatorium
i can tell you how to do the butt chet put in x&butt
1 0
Kody tm3kbond
11/29/2016 1:55 PM
Pridemoor Keep
ARGH
2 0
maxwell swagbro20
11/29/2016 1:19 PM
Plains (Plague)
true
1 0
Joey joeyButtons
11/29/2016 12:51 PM
Plains
2 0
Andrew ExtraHand
11/29/2016 9:04 AM
Plains
1 0
sawdgfuqip matthew4692
11/28/2016 7:19 PM
The Lich Yard
easssyyyyyy
0 0
sawdgfuqip matthew4692
11/28/2016 6:42 PM
Plains
hi
0 0
paul paulywagzydodo
11/28/2016 6:16 PM
Tower of Fate: Ascent
k
2 1
bolitas bolitas5
11/28/2016 6:03 PM
Campiña
chido
2 0
Aaron EAIWiiU
11/28/2016 5:12 PM
Explodatorium
Beat Plague Knight first try without items.
5 0
randy lilrandy2
11/28/2016 5:06 PM
Plains
cannot touch this
1 0
Dev AveRak120
11/28/2016 4:40 PM
Plains
oiui
3 0
Bone MegaBone
11/28/2016 2:02 PM
Plains
cool
0 0
Ethan.n VacVegas1
11/28/2016 12:56 PM
Pridemoor Keep
2 0
liltomatoe Liltomatoe
11/28/2016 10:14 AM
The Lich Yard
This is Easy
3 0
elvis.dura elvis.duran1609
11/28/2016 6:24 AM
Finca de Liches
2 0
Noah SheepishKnightly
11/27/2016 6:29 PM
Pridemoor Keep
Shovel justice on the first try! Finally getting back into the GnG feel.
0 0
Daddy D jdesing
11/27/2016 5:33 PM
Stranded Ship (Plague)
boi
1 0
Ben craftycraftling
11/27/2016 3:24 PM
The Lich Yard (Plague)
bam butt
2 0
Yetiman yetiman555
11/27/2016 1:57 PM
Explodatorium
help
3 0
Aidan aidan_doyle
11/27/2016 1:44 PM
The Lich Yard
3spooky5me
1 0
Aidan aidan_doyle
11/27/2016 1:39 PM
Troupple Pond
Wut?
0 0
Aidan aidan_doyle
11/27/2016 1:34 PM
Pridemoor Keep
King Knight really needs to fix his chandeliers
6 0
dignin dignin
11/27/2016 1:30 PM
Plains
0 0
Aidan aidan_doyle
11/27/2016 1:23 PM
Pridemoor Keep
2nd level, and I am already at a castle
2 0
Aidan aidan_doyle
11/27/2016 1:17 PM
Plains
Only you can prevent forest fires.
4 0
Aidan aidan_doyle
11/27/2016 1:03 PM
Plains
Skeletons!
2 0
Aidan aidan_doyle
11/27/2016 12:59 PM
Plains
Played this on the 3DS, now for the Wii U!
2 0
Ghosty ArtsyGhost22
11/27/2016 12:28 PM
Plains
4 1
CC|Cip★ pistufo
11/27/2016 9:00 AM
Pridemoor Keep
4 0
Kadin minecraftwar
11/27/2016 8:13 AM
The Lich Yard
hard but thats the point
2 0
elvis.dura elvis.duran1609
11/27/2016 8:01 AM
Villa
1 0
デアデイ Banjican
11/27/2016 6:03 AM
The Lich Yard
too hard
0 0
ThatGuy 75FoxGamer
11/27/2016 5:12 AM
Armor Outpost
I cant beat the shovel party
4 0
tomas GaseusRelics
11/26/2016 10:28 PM
Campiña
esta interesante el shovel knight
1 0
eli joanna525
11/26/2016 5:19 PM
Plains (Plague)
1 0
ProGamez29 caedo9119
11/26/2016 5:07 PM
Plains
0 0
Christian ChristianLee04
11/26/2016 2:28 PM
The Lich Yard
3 0
madden mjskywalker7
11/26/2016 1:13 PM
Plains
1 0
Nick nb8298
11/26/2016 11:22 AM
Iron Whale (Plague)
Treasure knight is waaaay to easy in Plague of Shadows
0 0
David mrbarpil
11/26/2016 11:15 AM
The Lich Yard
0 0
Popo georgeomatic
11/26/2016 10:52 AM
Village (Plague)
Just got the creep feat
3 0
Forgotten forgotten1103
11/26/2016 9:35 AM
Explodatorium
1 0
Mamaface CallerRydia
11/26/2016 8:44 AM
Pridemoor Keep
2 0
Mamaface CallerRydia
11/26/2016 8:43 AM
Pridemoor Keep
g
1 0
DanielDash DanielDash
11/26/2016 6:58 AM
Finca de Liches
This game is amazing
3 0
3-D levk360
11/25/2016 11:25 PM
Finca de Liches
muy buenoqq
2 0
Slicy Mii slicerlarry
11/25/2016 8:58 PM
Plains
whooa good game!!!
3 0
icebear43 loveamiboyay1562
11/25/2016 4:45 PM
Village (Plague)
all hail troupple king. king of fish and fruit long may his stem grow!!!!!
2 0
dr.elmo jakedadmom
11/25/2016 4:08 PM
Pridemoor Keep
the boss has 10 hearts like in minecraft!
3 0
poohead dec21607
11/25/2016 1:10 PM
Troupple Pond
how do u change your armor
2 1
poohead dec21607
11/25/2016 1:09 PM
Troupple Pond
his dance sucks
1 0
matt mattymatt1248
11/25/2016 11:31 AM
Tower of Fate: Entrance
so hard
1 0
puppmaster GriffysBoy
11/25/2016 9:34 AM
Pridemoor Keep
1 0
EGG Argosri
11/25/2016 8:40 AM
Plains
8 0
Reality RealityJake
11/25/2016 6:21 AM
Explodatorium
why the diffitculty
0 0
Romulus bhaskarb
11/24/2016 9:08 PM
Explodatorium
use phase locket a lot
0 0
dr.elmo jakedadmom
11/24/2016 8:52 PM
Plains
sharpen thy shovel the dumb one ever
3 0
Jake JakeDaPug
11/24/2016 8:26 PM
Plains
STEEL THY SHOVEL!!!!!!!!!!!!!!!1111one
2 0
Matthew Mat606
11/24/2016 6:53 PM
Armor Outpost
#shovel's no weopon dat wat makes shovel knight so dang cool!!!!!!
1 0
Mom clp121478
11/24/2016 5:46 PM
Pridemoor Keep
l rate this game 10/10
1 0
SAUMON.H saumonharengthon
11/24/2016 4:20 PM
Tour du Destin : Entrée
J'ai vaincu!
0 0
Joshua T. Joshe13
11/24/2016 3:29 PM
Lost City
i wish i could play as this one
2 0
KnotLocks KnotLocks
11/24/2016 3:07 PM
The Lich Yard (Plague)
2 0
julio2 victorloredo21
11/24/2016 1:17 PM
Fortaleza del Orgullo
1 0
Popo georgeomatic
11/24/2016 11:35 AM
Iron Whale
If you die in one hit you need the Phase Locket.
1 0
Popo georgeomatic
11/24/2016 11:31 AM
Iron Whale
I can't believe I made it this far.
1 0
bob jwautry21
11/24/2016 11:05 AM
Plains
4 0
EdGe BoY skoogs
11/24/2016 11:03 AM
Clockwork Tower
i might be the only one who does this but because i suck and i get angry and start making up flaws
1 0
Catie BeagleTV1
11/24/2016 8:18 AM
Iron Whale
bleh
1 0
Andy Flare7602
11/24/2016 6:07 AM
Iron Whale
this game is hard, but easy at the same time
0 0
Tenedor xavierloko1
11/24/2016 4:36 AM
Forest of Phasing
i like bananas
1 0
old Nolan hellrazor842002
11/24/2016 2:13 AM
Village
how do you get the infinidagger
4 1
Alex alexm1234
11/23/2016 8:26 PM
The Lich Yard
i die on this part were it drops
4 0
dr.elmo jakedadmom
11/23/2016 8:04 PM
Plains
Is donald a character?
0 0
Popo georgeomatic
11/23/2016 7:22 PM
Tower of Fate: ????
FIRST TRY
0 0
Oji :D SmartojusU
11/23/2016 6:55 PM
The Lich Yard
0 0
Oji :D SmartojusU
11/23/2016 6:08 PM
Troupple Pond
1 0
Oji :D SmartojusU
11/23/2016 6:07 PM
Troupple Pond
2 0
poqest mickey18
11/23/2016 6:05 PM
Tower of Fate: Entrance
beats him
0 0
Oji :D SmartojusU
11/23/2016 5:52 PM
Plains
0 3
Oji :D SmartojusU
11/23/2016 5:33 PM
Plains
3 0
Isaiah lwmcalpinegmail
11/23/2016 4:59 PM
Tower of Fate: ????
1 0
Popo georgeomatic
11/23/2016 4:42 PM
Clockwork Tower
Dr.Wily Confirmed
0 0
Popo georgeomatic
11/23/2016 4:27 PM
Frigid Flight
All I needs is bombs and arcana
2 0
steven steveaskins
11/23/2016 4:16 PM
Iron Whale
I love this game!!!! So cool!!!
1 0
noah rfdino
11/23/2016 3:02 PM
Pridemoor Keep (Plague)
2 0
CRAZY NATE CRAZY-NATE
11/23/2016 1:37 PM
Iron Whale
WHY ARE WATER LEVELS ALWAYS SO HARD!!!!
0 0
Brendan pastrymadman2015
11/23/2016 1:00 PM
Pridemoor Keep
0 0
Isaiah lwmcalpinegmail
11/23/2016 12:55 PM
Troupple Pond
1 0
Reality RealityJake
11/23/2016 12:52 PM
Explodatorium
0 0
Brendan pastrymadman2015
11/23/2016 12:50 PM
Pridemoor Keep
I just got this game yesterday and I'm on specter night all ready! P.S.i LOVE this game
1 0
mogard mogardo
11/23/2016 11:28 AM
Plains
im the best
1 0
D.Yoshi Rushbygarden
11/23/2016 10:22 AM
Troupple Pond
Why do I always pick dance you say?Because it dances like mettaton!!!!!
2 1
Tingle coolbeanswag03
11/23/2016 9:34 AM
Iron Whale
0 0
jaybee chasinglib
11/23/2016 7:30 AM
Plains
Playing shovel knight.. looks like a NES classic
3 0
Brendan pastrymadman2015
11/23/2016 6:23 AM
The Lich Yard
2 0
Brendan pastrymadman2015
11/23/2016 6:13 AM
The Lich Yard
2 0
Brendan pastrymadman2015
11/23/2016 6:00 AM
The Lich Yard
1 0
Snake toon_hero89
11/23/2016 12:33 AM
Máquina Voladora
necesito de alguna reliquia que aun no tengo para llegar a la partitura?
0 0
Chaz chaz27
11/22/2016 7:05 PM
Pridemoor Keep
Screw the girl! Get the money!
4 0
destructer tepsnod1
11/22/2016 6:01 PM
The Lich Yard
i broke the fist checkpoint soooooo, i'm screwed
3 0
Brendan pastrymadman2015
11/22/2016 4:08 PM
The Lich Yard
1 0
Dr.Bonk M3RKBON3S
11/22/2016 3:45 PM
Village (Plague)
I have so much fun with plague knight!
5 0
Brendan pastrymadman2015
11/22/2016 2:23 PM
The Lich Yard
1 0
Brendan pastrymadman2015
11/22/2016 2:11 PM
Pridemoor Keep
1 0
Queen_ marcos126
11/22/2016 1:57 PM
The Lich Yard
this is easy but i died alot
1 0
Brendan pastrymadman2015
11/22/2016 12:38 PM
Plains
1 0
zpark ramirez10
11/22/2016 12:31 PM
Explotatorium
derrote a un mago pobre jajajaj
1 0
zpark ramirez10
11/22/2016 12:27 PM
Explotatorium
que juegasooooo
0 0
Cornelius CornGames
11/22/2016 9:45 AM
Pridemoor Keep
1 0
Bradly Bradly360
11/22/2016 6:14 AM
Explodatorium
shovel knight!!!
2 0
LordGandar LordGandar
11/22/2016 5:45 AM
Lost City
aeHooooo
0 0
sergio sergi1990
11/22/2016 12:03 AM
Villa
shovel valiente caballero!
0 0
Viox VioxAerovio
11/21/2016 7:53 PM
Campiña
el mejor juego 8bits
1 0
Tingle coolbeanswag03
11/21/2016 7:00 PM
The Lich Yard
2 0
Cornelius CornGames
11/21/2016 6:03 PM
Plains
:'-(
1 0
Cornelius CornGames
11/21/2016 6:02 PM
Plains
camping yay
0 0
Cornelius CornGames
11/21/2016 6:01 PM
Plains
yeaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa i beat black butt
0 0
Jordan BigTracey
11/21/2016 5:57 PM
The Lich Yard
This game is impossible and curiosity kinged the cat .
2 1
Cornelius CornGames
11/21/2016 5:54 PM
Plains
0 0
Cornelius CornGames
11/21/2016 5:51 PM
Plains
how
0 0
Cornelius CornGames
11/21/2016 5:43 PM
Plains
:-(
8 0
jacole_007 jacole_007
11/21/2016 5:05 PM
Encounter - Black Knight
,
3 0
Frisk Billyisluigi
11/21/2016 2:19 PM
Pridemoor Keep (Plague)
1 0
joaco joacoylu
11/21/2016 2:12 PM
Nave Varada
0 0
Pollax freddyfender
11/21/2016 11:53 AM
Hall of Champions
yay shovel knight
2 0
**** neverenderman
11/21/2016 11:37 AM
Village
2 0
Ryan newlowell
11/20/2016 7:07 PM
Stranded Ship
awesome boss
0 0
yo Zero1542
11/20/2016 2:49 PM
Villa
pobre mujer de los cubos
3 0
meghan cupcakecore
11/20/2016 2:12 PM
Pridemoor Keep
Eat shovel, dork!
0 0
yo Zero1542
11/20/2016 1:50 PM
La Ciudad Perdida
2 0
Hector Ganguita
11/20/2016 1:44 PM
Campiña
0 0
alexis snapy15
11/20/2016 12:20 PM
Plains
pl''f'
0 0
DYLAN donutmandude
11/20/2016 10:10 AM
Lost City
i dont know how to do this part on lost city!!!!!
1 0
Popo georgeomatic
11/20/2016 8:31 AM
Plains
Im playing Butt Butt
2 0
Popo georgeomatic
11/20/2016 8:21 AM
Plains
Speedrun code: CRQHXNWO You will run fast but die in one hit
0 0
Popo georgeomatic
11/20/2016 8:20 AM
Plains
Im using a speedrun code To use a code make a new profile and enter the code as your name.CRQHXNWO
0 0
Christien CycloneC
11/20/2016 8:09 AM
Explodatorium
Yeah no kidding... jeeze... wel I did it!
3 0
kirby oiram9
11/20/2016 7:42 AM
Lost City (Plague)
ok I just (almost) have 100%!!!
5 0
Mike Sonic345232
11/20/2016 6:45 AM
Forest of Phasing
just getting treasure from the forest of phasing
5 0
matt mattymatt1248
11/20/2016 4:40 AM
Flying Machine (Plague)
playing as plauge knight
0 0
Dalton WiiMan1234
11/19/2016 7:06 PM
Plains
i got stuck on level 1
0 0
collin 102_hilltop
11/19/2016 5:33 PM
The Lich Yard
0 0
penguinfun penguinhunt
11/19/2016 5:20 PM
Plains
new game this is amazing
1 1
CJ CreeperSlash52
11/19/2016 4:16 PM
The Lich Yard
0 0
Mengh529 M18955
11/19/2016 3:17 PM
Flying Machine
kill me T_T
0 0
Matt Coolguy52203
11/19/2016 2:37 PM
Plains
Co-op is fun on this game :)
2 0
antonio emyrbubo
11/19/2016 2:03 PM
Plains
to doidao
0 0
Christien CycloneC
11/19/2016 12:27 PM
The Lich Yard
2 0
Christien CycloneC
11/19/2016 12:22 PM
The Lich Yard
whyyyyyy is this sooo harrddd???!!!
1 0
Alex!!! Mr.cheezeeeeeeee
11/19/2016 12:17 PM
The Lich Yard
it rages you and it is not FUN
0 0
Christien CycloneC
11/19/2016 12:16 PM
The Lich Yard
This game is fun! I just got it yesterday! its relly hard though
5 0
casey lipsticknlattes
11/19/2016 12:02 PM
Flying Machine
I WILL KILL PROPELLER KNIGHT FOR THIS STAGE!!!!
5 0
Theopold!? tyoier
11/19/2016 11:57 AM
Tower of Fate: Ascent
shouldn't the water spill out the window?
5 0
Theopold!? tyoier
11/19/2016 11:56 AM
Tower of Fate: Ascent
Well, this is akward...
3 0
Theopold!? tyoier
11/19/2016 11:42 AM
Flying Machine
weeee!
1 0
Theopold!? tyoier
11/19/2016 11:37 AM
Flying Machine
0 0
Theopold!? tyoier
11/19/2016 11:34 AM
Flying Machine
READING THIS IS A WASTE OF TIME
0 0
Theopold!? tyoier
11/19/2016 11:31 AM
Flying Machine
I HAD AN SUPER-INVCIBLILITY CHEAT AND I DIED?!?!?!?
5 0
Theopold!? tyoier
11/19/2016 11:28 AM
Flying Machine
I can hear my mom through the REAL-LIFE heating vent...
2 0
Theopold!? tyoier
11/19/2016 11:22 AM
Flying Machine
0 0
Theopold!? tyoier
11/19/2016 11:20 AM
Flying Machine
0 1
Theopold!? tyoier
11/19/2016 11:06 AM
Stranded Ship
Hi I used cheats
3 0
Theopold!? tyoier
11/19/2016 10:47 AM
Iron Whale
1 0
MagicWhale AllFlabAndNoAbb
11/19/2016 10:20 AM
Flying Machine
This music is sick
2 0
MagicWhale AllFlabAndNoAbb
11/19/2016 10:17 AM
Clockwork Tower
I beat this withought taking damage. There is a pattern thats easy to remember.
2 0
MagicWhale AllFlabAndNoAbb
11/19/2016 9:30 AM
Stranded Ship
0 0
MagicWhale AllFlabAndNoAbb
11/19/2016 9:25 AM
Village
I had to beat this game on steam then plague of shadows. NOW I HAVE TO DO IT AGAIN!!! But its fun :)
3 0
MagicWhale AllFlabAndNoAbb
11/19/2016 9:22 AM
Troupple Pond
3 0
Anakin celo02jan07
11/19/2016 9:21 AM
Pridemoor Keep
For now on I hate confetti
1 0
harrison briggs1234
11/19/2016 8:53 AM
Pridemoor Keep
hi guys
0 0
colton link21104
11/19/2016 8:27 AM
Village (Plague)
woo!!!
2 0
Tim Tim OfficialDup
11/19/2016 7:55 AM
Village
This game is great! I feel strangely nostalgic.
2 0
casey lipsticknlattes
11/19/2016 7:54 AM
The Lich Yard
SHIELD KNIGHT!
0 0
casey lipsticknlattes
11/19/2016 7:23 AM
Pridemoor Keep
almost forgot to upgrade my magic
2 0
casey lipsticknlattes
11/19/2016 7:12 AM
Plains
This is the best character in the game right here. :D
0 0
Cowhelmet Cowhelmet
11/19/2016 6:38 AM
Lost City
5 0
Theopold!? tyoier
11/19/2016 4:58 AM
Pridemoor Keep
0 0
Miles deejason
11/19/2016 3:31 AM
Iron Whale
Treasure knight level. I haven't gotten to the first checkpoint!!!
5 0
sasagix sasagix
11/19/2016 1:19 AM
Villa (Plague)
me encata el baile
1 0
william 03will
11/18/2016 11:38 PM
The Lich Yard
evan though i have beet it million times its still fun to play
0 0
william 03will
11/18/2016 11:36 PM
The Lich Yard
i cant stop playing this game !
1 0
Anakin celo02jan07
11/18/2016 8:31 PM
Pridemoor Keep
This is my favorite game!
1 0
Ragamuffin Kyle256
11/18/2016 8:21 PM
Troupple Pond
The Troupple King inspires me.
4 0
Custroy chatterdude
11/18/2016 7:34 PM
Encounter - Phantom Striker
I really hate these encounters.
2 0
Custroy chatterdude
11/18/2016 7:28 PM
Clockwork Tower
Just defeated Tinker Knight!
4 0
Papa MatCauthon
11/18/2016 7:27 PM
Rematch: King Knight
I KICKED HS BUT WITH A HALF HEART SHAKY HANDS AND FOUR SECONDS LEFT WOOOOOOOOOOOOOO
0 0
Papa MatCauthon
11/18/2016 7:23 PM
Rematch: King Knight
A FLIPPING HEART
0 0
Papa MatCauthon
11/18/2016 7:20 PM
Rematch: King Knight
he only had one heart onnnnnneeeee heeaarrtt
0 0
Kaaden kay1106
11/18/2016 5:58 PM
Plains
sup
2 0
michi Bebagamer
11/18/2016 5:19 PM
Campiña
logre ganar el primer boos
1 0
jt JTFIREGUN
11/18/2016 5:17 PM
Village
2 0
Theopold!? tyoier
11/18/2016 4:33 PM
Tower of Fate: ????
I don't need to be close because I have [SECRET]
3 0
Chaz chaz27
11/18/2016 4:18 PM
The Lich Yard (Plague)
Why is she dancing
0 0
CJ CreeperSlash52
11/18/2016 3:41 PM
The Lich Yard
amiibo to op!!!!!!
1 0
CJ CreeperSlash52
11/18/2016 3:34 PM
Pridemoor Keep
second boss down :) on a roll!!!!
0 0
CJ CreeperSlash52
11/18/2016 3:19 PM
Plains
let go boss down!!!!
0 0
mikey mikeyesposito
11/18/2016 3:11 PM
Stranded Ship
i forgot how to use the items
1 0
tommy Tiffcass
11/18/2016 1:47 PM
Plains
soooooooo hard
1 0
Korbin korbink123
11/18/2016 1:20 PM
Iron Whale
4 0
Sans! nanoboy590
11/18/2016 1:09 PM
Explodatorium
Why so hard?!
2 0
creeper791 Creeper791
11/18/2016 5:37 AM
Village
Amiibo Knights have fish heads and Baron Armor, and fire wakes, and also Black Knight's Evil Laugh!
3 0
Viox VioxAerovio
11/17/2016 8:25 PM
Campiña
ergv
4 0
Viox VioxAerovio
11/17/2016 8:24 PM
Campiña
2 0
Viox VioxAerovio
11/17/2016 8:21 PM
Campiña
2 0
Viox VioxAerovio
11/17/2016 8:20 PM
Campiña
yyevctbgg,ghtbkhtughnjojggb
1 0
JaidenGOC JaidenGOC
11/17/2016 6:40 PM
Village
just killed king knight
2 0
camman cammanb
11/17/2016 4:35 PM
Troupple Pond
oh noyo
0 0
Viox VioxAerovio
11/17/2016 3:36 PM
Campiña
2 0
Viox VioxAerovio
11/17/2016 3:26 PM
Campiña
2 0
Viox VioxAerovio
11/17/2016 3:24 PM
Campiña
vhbghfhnvvb
2 0
Viox VioxAerovio
11/17/2016 3:23 PM
Campiña
2 0
colton link21104
11/17/2016 12:05 PM
The Lich Yard
ya kinda
0 0
Dakota hypersonic123456
11/17/2016 11:09 AM
Encounter - Phantom Striker
i defeated the phantom striker
0 0
Dakota hypersonic123456
11/17/2016 11:02 AM
Stranded Ship
what color armor do you have now
1 1
Maxdeath Maxdeath
11/17/2016 10:05 AM
Campiña
Partiendo y es muy bueno....
0 0
Steve Anderson101
11/15/2016 9:50 PM
Tower of Fate: Ascent
Love this game. Thank you creators! I'd love to see a 32-bit style or 3d adventure next!
0 2
Custroy chatterdude
11/15/2016 7:15 PM
Encounter - Baz
Defeated Baz with one health left!
0 0
Custroy chatterdude
11/15/2016 7:04 PM
Lost City
Mole knight was actually easy for me to defeat
0 0
Custroy chatterdude
11/15/2016 6:08 PM
Troupple Pond
I angered him, lol
1 0
Papa MatCauthon
11/15/2016 4:40 PM
Troupple Pond
Dude just dude wierd dance
0 0
casey lipsticknlattes
11/15/2016 3:22 PM
Iron Whale
WHY IS THIS STAGE SO HARD!!!!!!!!!!!! THE IS EASIEST WAY IS USE THE LOCKET 99 TIMES!!!!!!!!!!!!
0 0
casey lipsticknlattes
11/15/2016 3:07 PM
Iron Whale
i litteraly got smacked by the fish and then died in a hole
3 0
IZRL Izrael_RDZ
11/15/2016 3:02 PM
Knuckler's Quarry
Shovel power
2 0
Taco MechanicalGuy
11/14/2016 7:37 PM
Explodatorium (Plague)
playing as the alchemist is weiirrrd
5 1
Spooticus Ultraspoot
11/14/2016 7:17 PM
Armor Outpost
Watch Buried In Wires play Shovel Knight on YouTube! Search Buried In Wires!
3 0
highlife highlifeleader
11/14/2016 6:59 PM
Plains
reminds me a lil,like wizard and warriors for nes dope "':)
3 0
Custroy chatterdude
11/14/2016 6:58 PM
Encounter - Reize
Didn't know he was going to kill me
3 0
Custroy chatterdude
11/14/2016 6:55 PM
Explodatorium
Wow, Plaque Knight was hard.
4 0
tom TommyTom8
11/14/2016 6:15 PM
Plains
hello?
0 0
tom TommyTom8
11/14/2016 6:14 PM
Plains
sooo hard
0 0
David dgaliata
11/14/2016 5:28 PM
Village
ben has all amer on vis game
0 0
David dgaliata
11/14/2016 5:25 PM
Village
0 0
David dgaliata
11/14/2016 5:21 PM
Village
my coud for Lexeu is 42966 42966
1 0
David dgaliata
11/14/2016 5:15 PM
Village
how do you play as plugniut so me if you know post it on miivers or come to my home
1 0
MLGPROHACK Hairypawter
11/14/2016 4:03 PM
Village
just beat mole knight
0 0
casey lipsticknlattes
11/14/2016 3:53 PM
Plains
finally beat black knight in this hard mode ps all enimes hit 4x harder
0 0
MLGPROHACK Hairypawter
11/14/2016 3:53 PM
Lost City
EVERYONE SPAM DAB IN THE CHAT!!!!!
1 0
casey lipsticknlattes
11/14/2016 3:46 PM
Plains
doing a kinda hard mode cheat and black knight is hard
3 0
Airbear troublemaker9300
11/14/2016 1:28 PM
Plains
ur mom
2 0
Shipu Shipu007
11/14/2016 8:08 AM
Campiña
lol
0 0
Lando bobcat.cannon
11/13/2016 9:19 PM
Plains
4 0
Lando bobcat.cannon
11/13/2016 9:09 PM
Plains
yytjhngmm',kkmjdjjmfddikkingkxgkkidsdkckixkindkddfjdjjcdjdjjdm!
2 0
Lando bobcat.cannon
11/13/2016 9:02 PM
Plains
2 0
The alien Determinaton
11/13/2016 6:57 PM
The Lich Yard
this game is so hard... :(
4 1
MoM BryM4N12
11/13/2016 6:50 PM
Plains
i just started the game its good so far
3 0
Custroy chatterdude
11/13/2016 6:43 PM
Plains
I beat the first boss!
0 0
Hayden StealthLynx611
11/13/2016 6:39 PM
The Lich Yard
use relics well to decimate your foes!
1 0
EdGe BoY skoogs
11/13/2016 4:04 PM
Stranded Ship
i died
0 0
EdGe BoY skoogs
11/13/2016 4:00 PM
Stranded Ship
the ice flakes damage you........ of course they do
0 0
EdGe BoY skoogs
11/13/2016 3:51 PM
Stranded Ship
just got the war horn areant i decked
3 0
EdGe BoY skoogs
11/13/2016 3:49 PM
Stranded Ship
wolves as enimeis PEEEETTTAAA someones being a meanie
1 0
EdGe BoY skoogs
11/13/2016 3:44 PM
Stranded Ship
puzzles in a platformer i think not of such foolishness
6 0
GameTime Hario871
11/13/2016 3:34 PM
Iron Whale
SHRPEN THI SHOVEL
2 0
JOH HighLordM
11/13/2016 3:25 PM
Plains
Just got the game! I suck...
2 0
EdGe BoY skoogs
11/13/2016 3:20 PM
Stranded Ship
im roleplaying as minecraft yotuber being an idiot ......subscirbe
0 0
EdGe BoY skoogs
11/13/2016 3:18 PM
Stranded Ship
hello darkness my old freind ive come to talk with you again a slight vision without speaking
3 0
EdGe BoY skoogs
11/13/2016 3:14 PM
Stranded Ship
slips and dies GAME OVER YEEEEEAAAH throws controller at tv
3 0
EdGe BoY skoogs
11/13/2016 3:11 PM
Stranded Ship
the diggers diary is bassically a better youtube comment sectoion
7 0
Chaz chaz27
11/13/2016 2:02 PM
Tower of Fate: ????
150th times a charm
11 0
Luka kimiluka
11/13/2016 1:13 PM
Encounter - Reize
i did it! oh dyaem
0 0
Nathan FourthFloor
11/13/2016 12:40 PM
Encounter - Reize
I'm just sitting here with my fish head and he tryna kill me!
6 0
xStatic BIGHEATON6
11/13/2016 11:14 AM
Tower of Fate: ????
RAGHHHHH ENCHNATRESS IS SO HARD
4 0
striker hjohnson24
11/13/2016 6:30 AM
The Lich Yard
i love this game but im renting it but i want it for xmas
2 0
darren darren98765
11/13/2016 6:29 AM
Plains
how do you take out black night?
1 0
Declan A. laubenthala
11/13/2016 5:47 AM
Flying Machine
he was down to 1 and a half-lifes! now i have to start all over!
0 0
Declan A. laubenthala
11/13/2016 5:34 AM
Flying Machine
the tower of fath is only 2 levels away! i can do it!
0 0
Theopold!? tyoier
11/13/2016 5:14 AM
Flying Machine
1 0
Theopold!? tyoier
11/13/2016 5:12 AM
Flying Machine
I hate Propeller Knight...
1 0
Theopold!? tyoier
11/13/2016 4:30 AM
Flying Machine
1 0
Theopold!? tyoier
11/13/2016 4:29 AM
Flying Machine
0 0
Sope sci24680
11/12/2016 8:46 PM
Pridemoor Keep
Got my first relic(flare sword) and defeated King Knight. Awesomeness!
0 0
Zachary ToxicChozo
11/12/2016 7:13 PM
Explodatorium
I'm a few levels into my no relics run, and I've gotta say... it's pretty fun to play this way!
4 0
kenneth kmister243
11/12/2016 5:26 PM
The Lich Yard
how do you beat the second boss
1 0
kenneth kmister243
11/12/2016 5:01 PM
The Lich Yard
this game is hard but that is the fun! beating the hard game
4 0
David dgaliata
11/12/2016 4:58 PM
Tower of Fate: Entrance
that was hard but i beetet him.
1 0
Ross rosssydney
11/12/2016 4:14 PM
Tower of Fate: ????
I am so tired,,,
1 0
FudgeMint FudgeMintDay
11/12/2016 4:08 PM
Plains (Plague)
1 0
Theopold!? tyoier
11/12/2016 4:05 PM
Village
3 0
Theopold!? tyoier
11/12/2016 4:04 PM
Village
2 1
Theopold!? tyoier
11/12/2016 3:58 PM
Village
JUST STOP! BARD WILL STOP TOO!!!
1 0
Carmelo frankie911
11/12/2016 2:50 PM
The Lich Yard
best indie game ever
0 0
pwnguin WildPwnguin
11/12/2016 2:34 PM
Hall of Champions
Some sort of rosetta translation tool?
3 0
Lindz Frecklelicious89
11/12/2016 1:57 PM
Plains
how do i mske the jump with the bubble?
6 2
BRIAN JR. SHANTE84
11/12/2016 1:37 PM
Pridemoor Keep
General
0 0
cullen craffeyclan
11/12/2016 11:24 AM
Village
0 0
Declan A. laubenthala
11/12/2016 10:11 AM
Clockwork Tower
0 1
Declan A. laubenthala
11/12/2016 9:59 AM
Clockwork Tower
this level has got the beats!
3 0
Ethan junior122289
11/12/2016 9:41 AM
The Lich Yard
I Like this game
3 0
Butt Retoru
11/12/2016 8:48 AM
Iron Whale (Plague)
never leave idiots in charge of you level
4 0
Jacob rightbackatcha77
11/12/2016 8:46 AM
Pridemoor Keep
I hate this part with the spellbooks!
2 1
Evan Sevanz
11/12/2016 8:28 AM
Pridemoor Keep
I defeated King Knight!
0 0
Evan Sevanz
11/12/2016 8:06 AM
The Lich Yard
I defeated Spectre Knight!
0 0
daddyo tommyboy843
11/12/2016 7:26 AM
Plains
SHOVELS ARE AWESOME!!!
4 0
Evan Sevanz
11/12/2016 7:26 AM
Plains
I defeated Black Knight!
0 0
Improviser improviserPAT
11/12/2016 7:23 AM
Tower of Fate: Entrance (Plague)
yikes! Not sure what combonation of weapons I should use on this guy.
1 0
Evan Sevanz
11/12/2016 7:13 AM
Plains
It feels good to play this again!
2 0
Adam SmileyMan43
11/12/2016 7:03 AM
Pridemoor Keep
YACHT CLUB LOGOO
0 0
Adam SmileyMan43
11/12/2016 7:01 AM
Village
2016 gold... ILLUMINATI CONFIRMED
3 0
Theopold!? tyoier
11/12/2016 5:06 AM
Village
1 2
Theopold!? tyoier
11/12/2016 5:05 AM
Village
0 0
Theopold!? tyoier
11/12/2016 4:33 AM
Plains
how I died was just sad.
1 0
Draco Draco55555
11/11/2016 9:50 PM
Plains
1 0
Hunter HunterP04
11/11/2016 6:36 PM
Clockwork Tower
tower of fate here i come!
3 0
Kramer iguesswerepals
11/11/2016 6:02 PM
Forest of Phasing
No Sir, I don't like it!
2 0
Madi monstrmadi
11/11/2016 4:53 PM
Pridemoor Keep
1 0
NESpro unknownNES3d
11/11/2016 4:47 PM
The Lich Yard
Struggling to defeat the boss.
2 0
KOOOOOOO Sagethehedgehog1
11/11/2016 4:25 PM
Tower of Fate: ????
0 0
.......... jayvian06
11/11/2016 2:19 PM
Frigid Flight
2 0
BOB mdgtr2002
11/11/2016 8:49 AM
Village
Shovel Knight in the winter
5 0
CMJ quajzm
11/11/2016 7:01 AM
The Lich Yard
why is this so hard
1 0
sky gamer pterbeek
11/11/2016 6:07 AM
The Lich Yard
how duz me gett uppp
1 0
Theopold!? tyoier
11/11/2016 5:08 AM
Village
«‹←???
0 0
Theopold!? tyoier
11/11/2016 5:05 AM
Village
...2?
0 0
Theopold!? tyoier
11/11/2016 5:04 AM
Village
1...
0 0
Theopold!? tyoier
11/11/2016 5:02 AM
Village
...OR THIS?
0 0
Theopold!? tyoier
11/11/2016 4:59 AM
Village
MONA IS A TRAITOR! SHE HELPS PLAUGE KNIGHT!!!...IN PLAUGE MODE!
0 0
Theopold!? tyoier
11/11/2016 4:56 AM
Village
0 0
Theopold!? tyoier
11/11/2016 4:55 AM
Village
have you ever seen Specter spinning a BOTTLE!? MY DAD DID!!! IN THE ENDING OF THIS GAME!!!!!
0 0
Theopold!? tyoier
11/11/2016 4:50 AM
Village
~!@#$%!!!
0 0
Theopold!? tyoier
11/11/2016 4:47 AM
Village
When do you see THIS sprite of the Deposed King? <
2 4
Theopold!? tyoier
11/11/2016 4:42 AM
Village
what does the GREEN one do?
1 0
Theopold!? tyoier
11/11/2016 4:40 AM
Village
Am I in... 1. Mona's Lab 2. The Explodatordium 3. In the Streetpass Arena on the 3DS 4.The Diary
0 0
Theopold!? tyoier
11/11/2016 4:37 AM
Village
I , Enhanced Horse, am seen in BOTH modes like plauge AND shovel! can you find where?
0 0
Theopold!? tyoier
11/11/2016 4:33 AM
Village
‹‹who's this?«
1 0
Theopold!? tyoier
11/11/2016 4:32 AM
Village
where do you see mona standing?
0 0
Theopold!? tyoier
11/11/2016 4:31 AM
Village
«←Who is this?
0 0
msaad msaad300
11/10/2016 9:53 PM
Iron Whale
2 0
Nick Baxter105
11/10/2016 6:36 PM
Clockwork Tower
tinker knight is so easy-even in his giant robot form. btw, i LOVE his robot form
0 0
Arma ArmandoaCraft
11/10/2016 6:27 PM
Campiña
4 0
DEAD XD superboxytroll
11/10/2016 4:53 PM
Troupple Pond
who wants a hat? OR YOU COULD GIVE ME YOUR HELMET!!!!!
5 0
Declan A. laubenthala
11/10/2016 3:58 PM
Frigid Flight
1 1
Declan A. laubenthala
11/10/2016 3:48 PM
Village
boneymeal nice! i feel soo pumped up!
1 0
Tobias tobe954
11/10/2016 1:43 PM
Plains (Plague)
this game is awesome!
1 0
.......... jayvian06
11/10/2016 12:56 PM
Frigid Flight
1 0
.......... jayvian06
11/10/2016 12:49 PM
Frigid Flight
1 0
Dad mcentee37
11/10/2016 9:25 AM
The Lich Yard
w
1 0
beardo minamimoto
11/10/2016 8:20 AM
Village
Froggy here is actually the evil mastermind. Its why Big the Cat had to keep him under control.
1 0
beardo minamimoto
11/10/2016 8:17 AM
Plains
And MY shovel!
1 0
King Green KingGreen0
11/09/2016 8:48 PM
Flying Machine
Aww, really glad to see these cute little guys appear in later levels! They're my favorite enemies.
1 0
Pierre. Kaiza_Yoshi
11/09/2016 6:54 PM
The Lich Yard
Damn, games are difficult but that's why we love them.
3 0
Pug360 Pugs117
11/09/2016 4:59 PM
The Lich Yard
...
6 1
Monkeyman Monkeyman1209
11/09/2016 4:30 PM
Village
1 0
Tobias tobe954
11/09/2016 3:46 PM
The Lich Yard
level two beaten!
0 0
Aidan gruntslayer797
11/09/2016 3:42 PM
Village
Anyone else excited for "spectre of torment"?
1 0
Coss71 Cosseventyone
11/09/2016 10:28 AM
Máquina Voladora
propiamente derrotado en la parte derecha de la pantalla he
0 0
Coss71 Cosseventyone
11/09/2016 9:59 AM
Torre Mecánica
todo eso thinker knight???????? !!!!!
0 0
Coss71 Cosseventyone
11/09/2016 9:21 AM
Nave Varada
polar knight descongelado
0 0
David dgaliata
11/09/2016 6:55 AM
Flying Machine
0 0
baddogg811 baddogg811
11/09/2016 6:16 AM
The Lich Yard
5 0
Coss71 Cosseventyone
11/08/2016 9:17 PM
La Ciudad Perdida
y mooole doña maria jajaja
0 0
Coss71 Cosseventyone
11/08/2016 8:20 PM
Explotatorium
plague knight... out
0 0
Coss71 Cosseventyone
11/08/2016 7:50 PM
Ballena de Hierro
another one bites the dust yeah
0 0
Evyn DeadlyMist50
11/08/2016 7:47 PM
Village
1 0
Ben buuthepowerfull
11/08/2016 6:28 PM
Village
0 0
Luke x04568
11/08/2016 6:28 PM
Plains
Woo just got the game! best game evr!<3
7 0
Evyn DeadlyMist50
11/08/2016 6:22 PM
Plains
dope game
1 0
BOB mdgtr2002
11/08/2016 4:19 PM
Explodatorium (Plague)
Here's a glitch, use the leech liquid on enemies that can regenerate to gain health!
6 1
Theopold!? tyoier
11/08/2016 1:42 PM
Stranded Ship
1 0
Theopold!? tyoier
11/08/2016 1:37 PM
Stranded Ship
As if nothing was ever there!
0 0
Theopold!? tyoier
11/08/2016 1:29 PM
Plains
0 0
Theopold!? tyoier
11/08/2016 1:07 PM
Village
|||||||||||||||||||?
0 0
Theopold!? tyoier
11/08/2016 1:02 PM
Village
0 0
Theopold!? tyoier
11/08/2016 1:00 PM
Village
0 0
Theopold!? tyoier
11/08/2016 12:55 PM
Village
★★★★★★★★★★★★★★★★★★★★★★★★☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆★★☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆☆★ Table Knight!
0 1
Theopold!? tyoier
11/08/2016 12:52 PM
Village
INFINITE MUNS AND GOLDZEZ!!! you pay 100 and get two-hundred-something!!!
0 0
Theopold!? tyoier
11/08/2016 12:48 PM
Village
IT'S RAINING BOTTLES!!!
0 0
Theopold!? tyoier
11/08/2016 12:47 PM
Village
0 0
Theopold!? tyoier
11/08/2016 12:41 PM
Plains
DEATH TO THE BLACK ONE!!!
0 0
Theopold!? tyoier
11/08/2016 12:39 PM
Plains
not 8-bit...
2 0
Theopold!? tyoier
11/08/2016 12:38 PM
Plains
0 0
wdt56 Powermove92
11/08/2016 12:27 PM
Plains
Why can i not just
2 0
Theopold!? tyoier
11/08/2016 12:23 PM
Plains
ep¦contd.|…but the knight didn't tell Shovel Knight his name!
0 0
Theopold!? tyoier
11/08/2016 12:19 PM
Plains
ep¦|Shovel Knight sees another knight. shovel knight calls him "Rake Knight" because he had a rake…
1 1
Theopold!? tyoier
11/08/2016 11:47 AM
Plains
yup to tyler u
0 0
Theopold!? tyoier
11/08/2016 11:46 AM
Plains
This post contains spoilers.
3 0
Theopold!? tyoier
11/08/2016 11:41 AM
Plains
1 0
☆★☆Alex☆★☆ Alexmega30
11/08/2016 11:17 AM
Pridemoor Keep
That was easy
0 0
☆★☆Alex☆★☆ Alexmega30
11/08/2016 11:14 AM
Troupple Pond
ALL HAIL TROUPPLE KING!
7 0
☆★☆Alex☆★☆ Alexmega30
11/08/2016 11:03 AM
Plains
Taking a Break, Just Chillin', Killin'.
0 0
☆★☆Alex☆★☆ Alexmega30
11/08/2016 11:03 AM
Plains
Just beat THE Black Knight
0 0
☆★☆Alex☆★☆ Alexmega30
11/08/2016 10:49 AM
Plains
Starting My 2nd playthrough after beating this game last year
2 0
Aaron HYAKURETSU-KEN
11/08/2016 10:45 AM
Pridemoor Keep
jeez you hair line my GOD ..........it killed me? dang u need to kut it. OVYISLY
1 0
Aaron HYAKURETSU-KEN
11/08/2016 10:33 AM
Explodatorium
NO NO NO NO NO NO AGIAN AND AGIAN!
3 0
Aaron HYAKURETSU-KEN
11/08/2016 10:31 AM
Explodatorium
OH fuz dumb FIRE uuuuuuu im tiyerd of this!
0 0
Theopold!? tyoier
11/08/2016 9:15 AM
Village
this game is EASY once you get the hang of it...
1 0
Theopold!? tyoier
11/08/2016 9:03 AM
Knuckler's Quarry
Ep2 Contd2| Spidy goes to the nurse and zomb goes to detention...
1 0
Theopold!? tyoier
11/08/2016 9:01 AM
Knuckler's Quarry
Ep2Contd1|They all play School.Then,Zomb jumps on Skelee but lands on Spidy.Ohno!Spidy is green now!
0 0
Theopold!? tyoier
11/08/2016 8:57 AM
Knuckler's Quarry
Tyary Ep2|Someone appears. Hobie says "who's that?". He says "ug! I am Zomb! rgh!" .|Zomb: Zombie|
0 0
Theopold!? tyoier
11/08/2016 8:51 AM
Knuckler's Quarry
Ep1 Cont'd|Creeps sees Creepy and says "why do all people like Shovel Knight? I like Paper Mario..."
0 0
Theopold!? tyoier
11/08/2016 8:48 AM
Knuckler's Quarry
Tyary EP1| Creeps says "HA! TAKE THAT, BAZ!" then uses his Mobile Gear in Shovel Knight.
0 0
Theopold!? tyoier
11/08/2016 8:41 AM
Knuckler's Quarry
Ty Show! Cast: Creepy: Paper Creeper|Creeps: Creeper|Skelee: Skeleton|Spidy: Spider|Hobie: Tiger.
0 0
Alexander mikethesmellydog
11/08/2016 7:36 AM
The Lich Yard
i cheat this game... sometimes
0 0
Bub bloomsdaydevice
11/08/2016 7:34 AM
Explodatorium (Plague)
that spider is shooting deathly pieces of candy corn
2 1
Theopold!? tyoier
11/08/2016 6:51 AM
Village
Chester is decked out for now...
0 0
Riley sonofjafar
11/08/2016 6:00 AM
Explodatorium
Finnaly bear Plague Knight. Huzzah
0 0
Theopold!? tyoier
11/08/2016 5:57 AM
Flying Machine
3 0
Theopold!? tyoier
11/08/2016 5:08 AM
Encounter - Baz
LIGHTING BAZ!?
3 0
Theopold!? tyoier
11/08/2016 4:35 AM
Iron Whale
X!|||||||||
0 0
Kif dukesjett
11/07/2016 5:42 PM
Hall of Champions
I just wish you could refight the boss...
6 0
Theopold!? tyoier
11/07/2016 5:19 PM
Hall of Champions
3 0
Monkeyman Monkeyman1209
11/07/2016 5:17 PM
Village
0 0
Monkeyman Monkeyman1209
11/07/2016 5:16 PM
Village
WHAT!
1 0
EdGe BoY skoogs
11/07/2016 5:03 PM
Clockwork Tower
HOW COULD THIS HAPPEN TO ME I MADE MY MISTAKES
3 0
Theopold!? tyoier
11/07/2016 4:41 PM
Explodatorium
0 0
Theopold!? tyoier
11/07/2016 4:11 PM
Lost City
lava vs slime!
1 0
Monkeyman Monkeyman1209
11/07/2016 3:27 PM
Village
0 0
L↑jpt JuanPablo5
11/07/2016 2:40 PM
Campiña
q raios
2 0
Christian ShoATGR
11/07/2016 2:29 PM
Village
Amiibo make Shovel Knight broken.
1 0
Theopold!? tyoier
11/07/2016 4:59 AM
Plains
1 0
Theopold!? tyoier
11/07/2016 4:54 AM
Explodatorium
brian fleeps?
0 0
Theopold!? tyoier
11/07/2016 4:48 AM
Explodatorium
0 0
Theopold!? tyoier
11/07/2016 4:36 AM
Explodatorium
hard
0 0
Theopold!? tyoier
11/07/2016 3:56 AM
Village
I have this game on my 2ds
0 0
Theopold!? tyoier
11/07/2016 3:53 AM
Village
0 0
mai kaneki197
11/06/2016 8:45 PM
Campiña
jeje por fin
0 0
Coss71 Cosseventyone
11/06/2016 6:34 PM
Villa
0 0
Coss71 Cosseventyone
11/06/2016 6:26 PM
Pridemoor Keep
yellow night defeated hell yeah
0 0
Logan HomeNetwork617
11/06/2016 4:51 PM
Explodatorium
i love the music on the stage
0 0
Logan HomeNetwork617
11/06/2016 4:49 PM
Troupple Pond
how do you fish. can someone tell me how to fish please
1 1
Taylor Hyrulexplorer
11/06/2016 4:23 PM
Explodatorium
Plauge Knight, friend's first attempt, coop. Died early, let him solo. beat it with last HP Huzzah!
0 0
Evan skylandsminecart
11/06/2016 4:17 PM
Lost City
just your average day falling in lava and holes
0 0
Mattias mattiasmul
11/06/2016 4:05 PM
Tower of Fate: ????
ALL HAIL OUR LORD AND SAVIOR, THE GRACEFUL DANCING TROUPPLE KING
5 0
Logan HomeNetwork617
11/06/2016 3:46 PM
Explodatorium
well then. the plague doctor knight was hard. but i did it. i just kept on hitting him.
5 1
evan wk_vrbs
11/06/2016 3:31 PM
Pridemoor Keep
fun but hard
1 0
Nikkis Shpee123
11/06/2016 3:30 PM
Village
Does anyone know the best time to start investing into a 401k?
1 0
Theopold!? tyoier
11/06/2016 2:08 PM
Plains
down dive dragon main
2 0
br13! lukesky2006
11/06/2016 11:20 AM
Armor Outpost
ra
2 0
Casheeshed casheeshed
11/06/2016 10:51 AM
Lost City
he's dead jim
1 0
EnderDude jakiebenzie
11/06/2016 10:17 AM
Pridemoor Keep
2 0
juan JJCarrasquero
11/06/2016 8:31 AM
Plains (Plague)
yo spectear knight for dlc
1 0
DYLAN donutmandude
11/06/2016 8:07 AM
Iron Whale
yusssss i beat treasure knight!!!
0 0
DYLAN donutmandude
11/06/2016 7:50 AM
Iron Whale
I cant beat treasure knight
1 0
DYLAN donutmandude
11/06/2016 7:28 AM
Iron Whale
at least i beat the angler part
3 0
DYLAN donutmandude
11/06/2016 7:22 AM
Iron Whale
im on the part on the iron whale with the angler fish and i keep dying and im so MAD!!!!
4 0
cristian cussumbo
11/06/2016 7:22 AM
Plains
bueno el juego
2 0
raiden raiden2015x
11/06/2016 7:14 AM
Armor Outpost
justice in spades!!!!!
1 0
FeFe fefelaw
11/06/2016 7:12 AM
Flying Machine
i love messing around with this guy
4 0
Bub bloomsdaydevice
11/06/2016 7:08 AM
Clockwork Tower
doez anyone have a good strat for his second stage
0 0
Nick firstnetid
11/06/2016 6:50 AM
Iron Whale
1 0
Jack SamuraiJack66
11/06/2016 5:23 AM
The Lich Yard (Plague)
the dark room before you fight Spectre Knight is brutal!
4 0
MetaShadow MetaShadow2000
11/05/2016 9:54 PM
Village
I'm already addicted to this game!!
3 0
Gabriel Gabrielcrack123
11/05/2016 4:23 PM
Iron Whale
Very hard!
0 0
WILLIAM 4v5b.h7frh
11/05/2016 4:22 PM
Plains
aghhhhhhhhhhhhhhhhh
2 0
Al RYUHAYABUSA5012
11/05/2016 4:13 PM
Lost City
is there an item to get in mole knight's stage?
3 1
Daniel Mc.Goob
11/05/2016 4:13 PM
Stranded Ship
~Strike The With Thy Mighty Shovel~
2 0
deez swagranger22
11/05/2016 3:41 PM
The Lich Yard
0 0
ôωõ☆Кеои★™ Nintendude101
11/05/2016 2:36 PM
Plains
Loving the game so far. It's really fun ^.^
4 0
Lucious 3dsboy12345
11/05/2016 2:35 PM
Flying Machine
thy flying airship is already taking a toll on my gold
2 0
Ben-Z-Boy WYco3-553
11/05/2016 2:35 PM
Village
nice game
0 0
Caleb The_Bossitron
11/05/2016 2:28 PM
Village
Do y'all know about the mini-game under the town?
1 2
Ian white_hound
11/05/2016 2:26 PM
Village
Doing new game plus on shovel mode and almost finished with plague mode! so fun!
1 0
Bub bloomsdaydevice
11/05/2016 1:04 PM
Knuckler's Quarry
how do u get past nucklers quarry????
1 0
Carls Carlsing11
11/05/2016 12:42 PM
Ballena de Hierro
Adios Treasure Knigth! un boss mas vencido
0 0
KnotLocks KnotLocks
11/05/2016 12:40 PM
Armor Outpost
as somerealorderposta'a!pij
6 0
Logan NarratorL
11/05/2016 11:54 AM
The Lich Yard
SPOOKY
0 0
Ray coolerj2004
11/05/2016 11:49 AM
Plains
sup
1 0
Nopo! Nopo321
11/05/2016 11:05 AM
Village
Hi just got this game 10/10 im having a blast playing!!!!
1 0
Crusher Crazylegs2005
11/05/2016 10:54 AM
Pridemoor Keep
King Knight suuuuuucks!
1 0
Baby Owen opjpnpkp
11/05/2016 10:44 AM
Iron Whale (Plague)
1 0
D'man$$$$$ jdthelegend
11/05/2016 10:27 AM
Explodatorium
How do you defeat Plauge Knight?????!!!!!!????!?
5 1
Andrew i-am_da_man95
11/05/2016 10:20 AM
Armor Outpost
0 0
Andrew i-am_da_man95
11/05/2016 10:02 AM
Plains
0 0
NerdTrform NatAndLukeWiiU
11/05/2016 9:50 AM
Explodatorium
not now
1 0
Edward jasonandkyle
11/05/2016 9:32 AM
Clockwork Tower
same, got all armor tho
1 0
NerdTrform NatAndLukeWiiU
11/05/2016 9:31 AM
Pridemoor Keep
3 0
tre tre3suber
11/05/2016 9:03 AM
Pridemoor Keep
i got a chat
3 0
char giants69
11/05/2016 8:19 AM
Explodatorium
0 0
Ryland walkers1981
11/05/2016 8:14 AM
Plains
abcs!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
0 0
Ryland walkers1981
11/05/2016 8:09 AM
Plains
i have to do that again!
1 0
Youval YOUVAL
11/05/2016 4:40 AM
Lost City
i beat mole kinght i almost gave up, but i found a speedrunner path!
1 0
Carls Carlsing11
11/04/2016 11:24 PM
Campiña
Con un juego mas a la lista por pasar! No lo juzguen por estar en bits, es bastante bueno el juego
0 0
Alex IShotTheMaid
11/04/2016 8:39 PM
Village
RDFJOOL
0 0
Ethan EthanDS2008
11/04/2016 8:37 PM
Plains
i have seen the infinidagger not in co-op
1 0
Esmilodont esmilodont
11/04/2016 7:40 PM
Explotatorium
menos mal no estudio para ninja
1 0
GodlyeGame GodlyeGaming
11/04/2016 7:20 PM
Village
0 0
Levi OLIVIADUNCAN
11/04/2016 4:17 PM
Village
how do you pass the third level but, i have money
2 1
Hack JazzyAleck399
11/04/2016 2:11 PM
Finca de Liches (Plague)
Hi Jay
3 0
GeekLogic HorrorG33K
11/04/2016 6:59 AM
Plains
Hey! Listen!
2 0
Esmilodont esmilodont
11/04/2016 2:11 AM
Campiña
hermoso juego, es mi época dorada de nes
0 0
Esmilodont esmilodont
11/04/2016 2:02 AM
Campiña
al fin tengo shovel knight. saludos desde la isla de margarita, venezuela
0 0
TylerU TheTylerGamer
11/03/2016 8:29 PM
Pridemoor Keep
King Knight DEAD first try! Now if only Spectre Knight was that easy for me...
1 0
ASHLEY OSUNNNA22
11/03/2016 7:08 PM
Campiña
shovel knigth es uno de mis juegos favoritos,les deseo suerte en su aventura camaradas
2 0
TylerU TheTylerGamer
11/03/2016 6:40 PM
Plains
Can I change my icon?
0 0
guada guadappers
11/03/2016 5:26 PM
Torre del Hado: ????
2 0
Punk punksudo
11/03/2016 3:36 PM
Village
Specter Knight wasn't that tough.
0 0
henry headofmariomaker
11/03/2016 2:31 PM
Village
just met the guy who represents me. he's cool.
1 0
Aislin Aislin2010
11/03/2016 2:12 PM
Pridemoor Keep
2 0
Chris xxchrisxx40
11/03/2016 1:51 PM
Campiña
0 0
Ian HANBERG1
11/03/2016 7:47 AM
The Lich Yard
this game is like super mario3 difficult sometimes
4 0
game boy redjack101
11/03/2016 7:25 AM
Armor Outpost
Why is life so hard!!!
2 0
crash k.l. CrashARooni
11/02/2016 4:43 PM
Plains
SK
0 0
a bobo303
11/02/2016 4:40 PM
Troupple Pond
sooo cool
2 0
Shane FunnyPharm
11/02/2016 1:44 PM
Tower of Fate: Entrance
at tower of fate sooo cool hala
1 0
EdGe BoY skoogs
11/02/2016 7:26 AM
Clockwork Tower
this game right here it needs a sequal
1 0
EdGe BoY skoogs
11/02/2016 7:23 AM
Clockwork Tower
gottias gos fasts
4 0
EdGe BoY skoogs
11/02/2016 7:20 AM
Clockwork Tower
SUCH INTENSE SPEED RUNNING GAMEPLAY
3 0
Ronan SmashBro6409
11/02/2016 5:40 AM
Flying Machine
um...where is the infinite dagger?
1 2
awsomguy jandjsims
11/01/2016 5:29 PM
Plains
this game reminds me of so many other old school games and its basically the only original thing
2 0
Mateo 2410SanJacinto
11/01/2016 4:22 PM
Flying Machine
omg starting a game+ was a bad idea.
0 0
AdrianoBRA AdrianoBRA
11/01/2016 3:31 PM
Village
como salva jogo?
0 0
RhombusGod rhombusgod
11/01/2016 2:41 PM
The Lich Yard
This game is chaotic in multiplayer
4 0
Tomito TomasMeza
11/01/2016 12:16 PM
Campiña
holi i died
0 0
Eden Eden9903
11/01/2016 8:56 AM
Tower of Fate: Ascent
the slime is real....
1 0
Eden Eden9903
11/01/2016 8:51 AM
Tower of Fate: Entrance
1 0
urich urichgaturro
10/31/2016 11:25 PM
Ballena de Hierro
Soy pro papus :v
0 0
EzyPledge EzyPledge
10/31/2016 9:26 PM
Plains
YAH!
1 0
Eden Eden9903
10/31/2016 8:51 PM
Stranded Ship
you can get arc of iron here on the three hammer tossers!
1 0
Eden Eden9903
10/31/2016 8:22 PM
Hall of Champions
0 0
Eden Eden9903
10/31/2016 7:52 PM
Frigid Flight
2 0
Eden Eden9903
10/31/2016 7:46 PM
Frigid Flight
3 0
Mateo 2410SanJacinto
10/31/2016 7:38 PM
Encounter - Phantom Striker
phase locket spam for the win
0 0
Mateo 2410SanJacinto
10/31/2016 7:35 PM
Frigid Flight
just use the propeller locket combo
2 0
Eden Eden9903
10/31/2016 7:16 PM
Flying Machine
0 0
Eden Eden9903
10/31/2016 6:34 PM
Clockwork Tower
1 0
raul linkbo55
10/31/2016 5:00 PM
The Lich Yard
is like luigi's masion
1 0
«I¢»Miguel zpokemigue123z
10/31/2016 4:38 PM
Plains
:v
3 0
X LordX19
10/31/2016 2:15 PM
Iron Whale
Tip : keepthrowing chaos spheres when Treasue Knight is on the ground
0 0
Mateo 2410SanJacinto
10/31/2016 2:14 PM
Stranded Ship
the amiibo player can do rainbow spit if they select it and press down
0 0
X LordX19
10/31/2016 1:32 PM
The Lich Yard
Deafeted Specter Knight easilyall you got to do is use the flare wand and dodge his sythe attacks.
0 0
X LordX19
10/31/2016 1:16 PM
The Lich Yard
Love this music!!!!!!
1 0
X LordX19
10/31/2016 12:57 PM
Pridemoor Keep
In King Knight's stage, if you go to the left you can get a music sheet there
1 0
X LordX19
10/31/2016 12:55 PM
Troupple Pond
That is the weirdest thing I ever saw in my LIFE!!!!!!!!!!
6 1
©pedro.c.™ 1994ped
10/31/2016 9:08 AM
The Lich Yard
game e bom demais na versao de play station tem o easteregg do kratos e vcs poderam batalhar com ele
2 0
Sebas Sea_Bass223
10/31/2016 8:17 AM
Pridemoor Keep
YES!!!!!!!!!!!!!!!!!
0 0
Sebas Sea_Bass223
10/31/2016 7:19 AM
The Lich Yard
:-/
1 0
elHonguito DryBones3D
10/30/2016 11:47 PM
Campiña
2 1
elHonguito DryBones3D
10/30/2016 11:43 PM
Campiña
hola shavos uwu
2 0
Jack firetiger8.3.2
10/30/2016 6:51 PM
Plains
amazing story
0 0
Malaki Malachi424
10/30/2016 6:25 PM
Village
Chester calls me blue guy and I picked the red armour
0 0
XDprince XDprince
10/30/2016 3:25 PM
The Lich Yard
4 1
Leo leoP11
10/30/2016 2:55 PM
Villa (Plague)
este juego es genial
5 0
BANANA gophergoggle
10/30/2016 2:15 PM
Pridemoor Keep
2 0
BANANA gophergoggle
10/30/2016 2:07 PM
Pridemoor Keep
king knights music is my favorite music!
0 0
BANANA gophergoggle
10/30/2016 2:02 PM
Pridemoor Keep
I Love bard
1 0
Santiago santiaguito05
10/30/2016 1:35 PM
Pridemoor Keep
you call yourselve king haaaaaa!!!!
5 0
lance lancetheglooob
10/30/2016 11:41 AM
The Lich Yard
0 0
lance lancetheglooob
10/30/2016 11:37 AM
The Lich Yard
going to kill specter knigh
0 0
Anklet Axe-C-Dent
10/30/2016 10:22 AM
Switch Hitters
id rather be a pig than a facist
2 0
Eden Eden9903
10/30/2016 8:39 AM
Tower of Fate: ???? (Plague)
0 0
Eden Eden9903
10/30/2016 8:35 AM
Tower of Fate: ???? (Plague)
try dancing!
2 0
Dayday sheenaparker
10/30/2016 8:22 AM
Village
i cleared the hall of fame
0 0
mint latte EGKnight58
10/30/2016 8:01 AM
Iron Whale
My shovel hungers for more gilders and precious apples. Forsooth!
1 1
nikos fishslapper
10/30/2016 7:25 AM
Plains (Plague)
it is i king kinght sayin gool luck on your run
6 0
lance lancetheglooob
10/30/2016 7:17 AM
Pridemoor Keep
0 0
Mommy caramgreen17
10/30/2016 6:55 AM
The Lich Yard
this is
2 1
lance lancetheglooob
10/30/2016 6:53 AM
Plains
my favorite platformer
0 0
Dylan dyland77
10/30/2016 6:46 AM
Pridemoor Keep
This lvl sucks
1 0
Ronan rtclegostarwars
10/30/2016 6:22 AM
The Lich Yard
eaven with my amiibo i coulden't beat this level. but i haven't tride co-op yet
1 0
Ronan rtclegostarwars
10/30/2016 6:20 AM
The Lich Yard
grrrrrrrrrrrrrrrr.
1 0
ultra Adam.henthorn
10/30/2016 6:04 AM
Plains
why isnt anyone talking to me
3 1
Ronan rtclegostarwars
10/30/2016 6:01 AM
The Lich Yard
i cant get my gold back
0 0
ultra Adam.henthorn
10/30/2016 5:55 AM
Plains
shovel knight is too hard
1 0
ultra Adam.henthorn
10/30/2016 5:51 AM
Plains
how do i beat the dragon the second time
1 1
ultra Adam.henthorn
10/30/2016 5:35 AM
Plains
this game is so hard
1 0
Justin justhamplease
10/30/2016 5:28 AM
Tower of Fate: Entrance
0 0
Ronan SmashBro6409
10/29/2016 4:21 PM
Iron Whale
the phase locket helps
2 0
Ronan SmashBro6409
10/29/2016 3:59 PM
Iron Whale
5 0
Frisk coolkid1256
10/29/2016 3:11 PM
The Lich Yard
BEST, GAME, EVER!!!!!!!!!!!!!!!
0 0
rssilva rssilva26
10/29/2016 1:56 PM
Plains
0 0
Sope sci24680
10/29/2016 1:54 PM
The Lich Yard
Just defeated Specter Knight. He was good and pretty tough.
6 1
jasper momjabbar
10/29/2016 12:23 PM
Hall of Champions
grumpy frog:i am so grumpy today
1 0
jos joselguapo2004
10/29/2016 12:14 PM
Campiña
2 2
Mateo 2410SanJacinto
10/29/2016 11:52 AM
Iron Whale
violet for favorite knight class anyone?
0 0
josh joshb2009
10/29/2016 11:28 AM
Hall of Champions
new armor. yay!!!!!!!!!!!!!!!
1 0
josh joshb2009
10/29/2016 11:27 AM
Hall of Champions
soooo easy
0 0
josh joshb2009
10/29/2016 11:26 AM
Hall of Champions
0 0
Dayday sheenaparker
10/29/2016 10:30 AM
Village
i got so mutch gold right now
0 0
Bacon WiiBaconBoy
10/29/2016 9:33 AM
Plains
amiibo function is awesome! Im starting the whole game over to level it up
1 0
Justin justhamplease
10/29/2016 5:32 AM
Hall of Champions
1 0
Justin justhamplease
10/29/2016 5:30 AM
Hall of Champions
0 0
Spriggit Spriggit
10/29/2016 1:06 AM
Pridemoor Keep
6 0
Dad etalet1976
10/28/2016 8:47 PM
Village
0 0
Brayden Commander_Pengin
10/28/2016 7:58 PM
Lost City
meme
1 0
Gabriel gabecard91
10/28/2016 7:18 PM
Plains
Cheat code!! it is x&butt
0 0
Colin ColinVarano
10/28/2016 5:01 PM
Plains
Beat the game on many profiles. I loved it!
3 0
Eden Eden9903
10/28/2016 3:29 PM
Lost City (Plague)
3 0
Otávio Otavio
10/28/2016 2:36 PM
Plains
joguinho bom kkk
3 0
Limee Rustii24
10/28/2016 2:16 PM
Clockwork Tower
stuck on tinker knight its such a pain
3 1
Ronan SmashBro6409
10/28/2016 1:27 PM
The Lich Yard
And....Done!
1 0
Ronan SmashBro6409
10/28/2016 1:24 PM
The Lich Yard
Specter Knight's DLC will be intresting...
4 0
Ronan SmashBro6409
10/28/2016 1:22 PM
The Lich Yard
Oh...boy Specter Knight on Game +....PREPARE FOR DEATH XD
2 0
Ronan SmashBro6409
10/28/2016 1:16 PM
The Lich Yard
Dark Area...On Game+!?! HELP MEH
1 0
ZeroAxis CobaltCharged
10/28/2016 12:36 PM
Iron Whale (Plague)
sohard
0 0
Andres supergamer1225
10/28/2016 12:34 PM
Pridemoor Keep
Got all the music sheets!
1 0
Andres supergamer1225
10/28/2016 12:33 PM
Pridemoor Keep
#YatchClubSecrets
1 0
Nin☆Luis luisnn
10/28/2016 4:27 AM
Fortaleza del Orgullo
Ya van dos
0 0
Nin☆Luis luisnn
10/28/2016 3:54 AM
Campiña
Derrote al primer jefe
2 0
Ptrk Budderman10
10/27/2016 9:15 PM
The Lich Yard
1 0
Chris Stachetopher
10/27/2016 6:07 PM
Troupple Pond
HAIL THE LORD OF FRUIT AND FISH! LONG MAY HIS STEM GROW!
4 1
Alfonso pikminology101
10/27/2016 5:41 PM
Iron Whale
I have personalized my knight to perfection.
0 0
zayden 2 Ilovezelda321
10/27/2016 3:37 PM
Flying Machine
I will faking make a bomb that blowes up T.Vs
0 0
zayden 2 Ilovezelda321
10/27/2016 3:35 PM
Flying Machine
flying machine is soooooooooo hard!
3 0
zayden 2 Ilovezelda321
10/27/2016 3:32 PM
Flying Machine
i feel ya
1 0
Jordan The3Guys
10/27/2016 7:20 AM
Tower of Fate: ????
...sigh.... -_-
4 0
Jordan The3Guys
10/27/2016 7:06 AM
Tower of Fate: Ascent
Here we go again... but with Custom Knight
0 0
Geetbeedie Geetbeedie
10/27/2016 1:37 AM
Iron Whale (Plague)
Plague Knight is one hot mama!
2 0
popcorn kylites
10/26/2016 9:20 PM
Plains
0 0
zelda toby0104
10/26/2016 3:32 PM
The Lich Yard
0 1
EdGe BoY skoogs
10/26/2016 3:08 PM
Flying Machine
BOSS TIME
1 0
EdGe BoY skoogs
10/26/2016 3:06 PM
Flying Machine
speed run over
0 0
EdGe BoY skoogs
10/26/2016 3:04 PM
Flying Machine
gittas gos fasts
1 0
dad packsfan
10/26/2016 2:42 PM
The Lich Yard
0 0
exploding ezraflores
10/26/2016 2:25 PM
Lost City (Plague)
i know plegue of shadows was fun
2 0
EdGe BoY skoogs
10/26/2016 2:19 PM
Flying Machine
a fall of despair
0 0
sayv crystal1017
10/26/2016 2:10 PM
Rematch: Remnant of Fate
easy
0 0
EdGe BoY skoogs
10/26/2016 1:21 PM
Flying Machine
this my favorite game but makes me rage
0 0
EdGe BoY skoogs
10/26/2016 1:16 PM
Flying Machine
1 0
mario MrJFH10
10/26/2016 12:56 PM
Clockwork Tower
0 0
mrk mrk158
10/26/2016 11:42 AM
Encounter - Phantom Striker
1 0
MicronMark MarkyMicron
10/26/2016 10:07 AM
Clockwork Tower
1 0
zeracks zeracks
10/26/2016 9:59 AM
Plains
classic fun!!
0 0
Lucas miniedogg
10/26/2016 9:44 AM
Lost City
6 0
EdGe BoY skoogs
10/26/2016 5:49 AM
Stranded Ship
0 0
EdGe BoY skoogs
10/26/2016 5:35 AM
Stranded Ship
i am so sad im so poor
0 0
seanmurray murray363511
10/26/2016 2:13 AM
Plains
shovel knight !!!!!!!!!!
6 0
seanmurray murray363511
10/26/2016 2:11 AM
Plains
2 0
Crecii MetalSnakyStar
10/25/2016 7:33 PM
Pridemoor Keep
king knight es el mejor :v
0 0
princess dragon45600
10/25/2016 6:36 PM
Frigid Flight
1 0
Eden Eden9903
10/25/2016 6:32 PM
Pridemoor Keep (Plague)
2 0
Ryan TFSTOTHEMAX
10/25/2016 5:30 PM
Explodatorium
To fellow knights, Day 3 has begun. Plauge Knight was difficult, but I manged, and is now defeated.
1 0
mrk mrk158
10/25/2016 5:23 PM
Village (Plague)
3 0
Oliver iamollie
10/25/2016 3:51 PM
Plains
this game is fun and really intense
6 0
JK jacksonkidwell
10/25/2016 3:30 PM
Village
just beat the game
3 0
Craig minecraftsonic1
10/25/2016 2:48 PM
Plains (Plague)
3 0
Craig minecraftsonic1
10/25/2016 2:45 PM
Plains (Plague)
#thebombswillsaveyou
1 0
zayden 2 Ilovezelda321
10/25/2016 2:45 PM
Village
i forgot my pass word for my other account so i have to use this one
0 10
L ShadowzI
10/24/2016 9:59 PM
Explodatorium
Another jumping rat, another explosion... another pit... darn it...
4 0
Haley Melancon86
10/24/2016 6:52 PM
Plains
5 0
Ethan TinyStark2006
10/24/2016 3:35 PM
Bonus - Pridemoor Keep (Plague)
1 0
EdGe BoY skoogs
10/24/2016 2:45 PM
Explodatorium
what am i supposed to do you cant double jump
0 0
Mason Gonzoiscool
10/24/2016 2:22 PM
Village
yolo
2 0
bear steph_lane
10/24/2016 1:39 PM
Tower of Fate: Ascent
Iunderstand you
0 0
Craig minecraftsonic1
10/24/2016 11:07 AM
Explodatorium
finnaly
1 0
Craig minecraftsonic1
10/24/2016 11:03 AM
Explodatorium
the plaque knight character campaign is so good
5 0
Craig minecraftsonic1
10/24/2016 10:58 AM
Explodatorium
the explatorum music is awesome
6 0
Craig minecraftsonic1
10/24/2016 10:55 AM
Village
4 0
Craig minecraftsonic1
10/24/2016 10:50 AM
Troupple Pond
0 0
Craig minecraftsonic1
10/24/2016 10:48 AM
Troupple Pond
sooooo coooool
0 0
Evan EvanJAbels
10/24/2016 10:02 AM
Plains
owen
3 0
alex TacoboyAlex
10/24/2016 10:01 AM
Village (Plague)
i cheated
16 0
Revel BackToVoltron
10/23/2016 9:57 PM
The Lich Yard
0 0
Revel BackToVoltron
10/23/2016 9:27 PM
Pridemoor Keep
0 0
Revel BackToVoltron
10/23/2016 8:54 PM
Village
4 0
grant pyrogs123
10/23/2016 3:24 PM
The Lich Yard
im am all ready in love with this game
0 0
Haley Melancon86
10/23/2016 3:05 PM
Village
0 0
L–man Kingofawesome75
10/23/2016 1:42 PM
Explodatorium
Plague Knight is my favorite of the Order. No doubt.
4 0
sayv crystal1017
10/23/2016 1:29 PM
Birder Herder
i collceted all but i didnt win?
3 0
sayv crystal1017
10/23/2016 1:23 PM
Extendo Retracto
impossible
2 0
sayv crystal1017
10/23/2016 1:13 PM
Rematch: Propeller Knight
i beat it at 0:00
2 0
sayv crystal1017
10/23/2016 12:59 PM
Unarmed Ascent
its easy
1 0
rok musclemanroko
10/23/2016 12:30 PM
Plains
wish me luck about to fight entrantress
1 0
zimzim zimzim3
10/23/2016 10:53 AM
Clockwork Tower
soo hard
3 0
Trysten Dragonlegends315
10/23/2016 10:33 AM
Plains
she is SO hard to beat!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!
0 0
Granpa TheSquallyBox
10/23/2016 10:17 AM
Plains
hi just got dis it is awesome
2 0
MaddSkillz MCMaddSkillz
10/23/2016 9:08 AM
Pridemoor Keep
2 0
MaddSkillz MCMaddSkillz
10/23/2016 9:07 AM
Pridemoor Keep
0 0
princess dragon45600
10/23/2016 7:31 AM
Iron Whale (Plague)
6 0
Ryan Hero_Of_HyruIe
10/23/2016 6:47 AM
The Lich Yard (Plague)
Yahoo! First try
0 0
Ryan Hero_Of_HyruIe
10/23/2016 6:14 AM
The Lich Yard (Plague)
That's your own problem
5 0
Haley Melancon86
10/22/2016 8:22 PM
Tower of Fate: Ascent
1 0
Ryan Hero_Of_HyruIe
10/22/2016 7:50 PM
The Lich Yard (Plague)
Just because of Chester you can tell that Plague of Shadows is a prologue.
1 0
Ryan Hero_Of_HyruIe
10/22/2016 7:13 PM
Plains (Plague)
Shovel Knight for Smash Bros DLC
1 0
Space Frog gamerkity
10/22/2016 6:56 PM
Plains
Me and my bud sucking at platforming
2 3
sans nanabeenanabee
10/22/2016 6:54 PM
Plains
chet code is tvsvueio
3 1
Ryan Hero_Of_HyruIe
10/22/2016 5:59 PM
Stranded Ship
God mode
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:56 PM
Encounter - Black Knight
God mode
0 0
JAMES superkipwad123
10/22/2016 5:55 PM
Plains
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:50 PM
Iron Whale
God mode
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:45 PM
Encounter - Baz
Butt cheat?
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:41 PM
Encounter - Reize
God mode
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:39 PM
Lost City
Using godmode
5 0
Ryan Hero_Of_HyruIe
10/22/2016 5:39 PM
Lost City
Easy with godmode
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:37 PM
Lost City
Ian:LOL
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:34 PM
Lost City
This stage has THE BEST music in my humble opinion.
2 0
Ryan Hero_Of_HyruIe
10/22/2016 5:33 PM
Explodatorium
Easy with godmode
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:30 PM
Explodatorium
Aaron are you still here
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:23 PM
Pridemoor Keep
JUSTICE IN SPADES
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:23 PM
Pridemoor Keep
Easy with god mode
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:20 PM
The Lich Yard
He is easy with god mode
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:13 PM
Plains
god mode
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:12 PM
Plains
I love the sheild knight dreams
3 0
Ryan Hero_Of_HyruIe
10/22/2016 5:11 PM
Plains
Easy with god mode!
0 0
Ryan Hero_Of_HyruIe
10/22/2016 5:07 PM
Plains
God mode is STQQTXVX
1 0
Ryan Hero_Of_HyruIe
10/22/2016 5:03 PM
Plains
#X&Butt
3 0
Jared Metamorph2000
10/22/2016 4:17 PM
Plains
1 1
alex TacoboyAlex
10/22/2016 4:02 PM
The Lich Yard (Plague)
plauge knight mode is hard
5 0
zombieking fishermerv
10/22/2016 3:51 PM
Plains (Plague)
hi
1 0
OrangeMayo BoomSonic123
10/22/2016 3:40 PM
Pridemoor Keep
0 0
Matthew unoyahtzee
10/22/2016 3:00 PM
Plains
Any tips speedrunning this level?
0 0
Teno Tenoslater
10/22/2016 2:14 PM
Pridemoor Keep
better nerf the flareo wand :/
0 0
Teno Tenoslater
10/22/2016 1:39 PM
Plains
me purky
1 0
frankie Provato68
10/22/2016 12:07 PM
Iron Whale
0 0
Johnny Xzonereaper345
10/22/2016 11:24 AM
Plains
Still waiting for more playable boss knights
2 0
Matthew Matthew9104
10/22/2016 9:06 AM
Troupple Pond
time to dig!
1 0
Daniel DJGT2003
10/22/2016 8:08 AM
Tower of Fate: Entrance
This game is so retro!
1 0
ian injami1
10/21/2016 10:18 PM
Pridemoor Keep
beat him with amiibo
1 0
Jake jakethedog94
10/21/2016 7:51 PM
Tower of Fate: Entrance
Whyy is this stage so hard??!!
4 0
Andrew ccoy123
10/21/2016 5:45 PM
Plains
this is awesome
3 0
jerjer jermaster
10/21/2016 3:37 PM
Explodatorium
4 0
wiiston wiiston
10/21/2016 3:27 PM
Flying Machine (Plague)
i see a secret
1 0
wiiston wiiston
10/21/2016 3:09 PM
Clockwork Tower (Plague)
no hits on me
0 0
wiiston wiiston
10/21/2016 3:08 PM
Clockwork Tower (Plague)
easyest boss ever
1 0
wiiston wiiston
10/21/2016 3:00 PM
Clockwork Tower (Plague)
the easyest boss gets the hardest level
3 0
wiiston wiiston
10/21/2016 2:36 PM
Troupple Pond (Plague)
he... spit on me
3 0
wiiston wiiston
10/21/2016 2:33 PM
Encounter - Black Knight (Plague)
YOU WILL PAY im gona GET You
1 0
wiiston wiiston
10/21/2016 2:26 PM
Stranded Ship (Plague)
his room is in his stage at boss fight we gong doun hole
0 0
zachary zskyjumper
10/21/2016 2:02 PM
Pridemoor Keep (Plague)
2 0
Mike Sonic345232
10/21/2016 7:55 AM
Explodatorium
UGHH! PLAUGE KNIGHT IS TOUGH!
1 0
Mee Not-A-Noob
10/20/2016 6:39 PM
Plains
One down ??? more to go.
0 0
Bubba hightower23
10/20/2016 5:58 PM
Stranded Ship
0 0
SkyeSaysHi scoop2016
10/20/2016 5:21 PM
Village
GET THE AMIIBO (seriously)
2 0
PoorKenny JoeFubar
10/20/2016 4:30 PM
Plains
0 0
mario MrJFH10
10/20/2016 3:45 PM
Clockwork Tower
best game in the world (^o^)
2 0
Zero poke28
10/20/2016 2:24 PM
Pridemoor Keep
0 0
Haley Melancon86
10/20/2016 1:52 PM
Tower of Fate: Ascent
3 0
Nathan nathanb1992
10/20/2016 1:48 PM
Village
lol
0 0
zyman zamblieslayer
10/20/2016 1:26 PM
Village
how do you get kratos armor
1 1
Jack chipchip10
10/20/2016 1:20 PM
Lost City
1 0
Splatooner mvalviar
10/20/2016 5:48 AM
Village
0 0
Bubba hightower23
10/19/2016 7:19 PM
Plains (Plague)
0 0
Daniel dpteo12345
10/19/2016 7:06 PM
Village (Plague)
Pandemonium Cloak is kind of gimmicky, but a really fun gameplay challenge.
4 0
Splatooner mvalviar
10/19/2016 6:19 PM
Armor Outpost (Plague)
2 0
Splatooner mvalviar
10/19/2016 6:13 PM
Armor Outpost (Plague)
1 0
Splatooner mvalviar
10/19/2016 6:10 PM
Armor Outpost (Plague)
1 0
FireBurst™ derpylovesdoctor
10/19/2016 5:34 PM
Explodatorium
this game is challenging
3 0
Plague <:= vitri0l
10/19/2016 4:34 PM
Pridemoor Keep (Plague)
Cannot possibly put into words how painful this looks.
4 1
princess dragon45600
10/19/2016 4:10 PM
Tower of Fate: Entrance
4 0
mario MrJFH10
10/19/2016 2:24 PM
Troupple Pond
best game ever!!!
1 0
m michealhaynes
10/19/2016 11:46 AM
Pridemoor Keep
i beat new game plus and then went back to normal game and it was easy.
1 0
ARCDRANZER TYRELPHOENIX
10/19/2016 10:25 AM
Villa
ya lo compre asi q ni modo a jugar
7 0
GrumPato watya19
10/19/2016 8:58 AM
Village
2 0
GrumPato watya19
10/18/2016 11:54 PM
Armor Outpost
SHOVEL POWAAAAAAH!
2 0
princess dragon45600
10/18/2016 5:58 PM
Hall of Champions
3 0
james liljpm123
10/18/2016 5:50 PM
Plains
its so hard it be mega mans match
0 0
Dr.Ernest ernest-family
10/18/2016 4:15 PM
The Lich Yard
sooooooooo hard
3 0
coolguy123 helpo159
10/18/2016 2:44 PM
Frigid Flight
..............................!
0 0
Matthew unoyahtzee
10/18/2016 2:37 PM
Flying Machine (Plague)
This stage is so hard!
2 0
Mr.Leo Gahoondy
10/18/2016 2:22 PM
Plains
I deafet black knight
0 0
Mr.Leo Gahoondy
10/18/2016 2:14 PM
Plains
this game is rigged
2 0
nick tiff0817
10/18/2016 1:14 PM
Knuckler's Quarry
' prankster knight ' hey guys umm lets make a movie ' king knight ' no lets look for shovel knight
0 0
Haley Melancon86
10/18/2016 10:14 AM
Tower of Fate: Ascent
qehbjlokkjnnnnnbnm,..'.,,,,,...........,,,,,,,,,............................'llll,l,&*^^?]()){{{[][[
1 0
David dgaliata
10/17/2016 7:44 PM
Village
!!!!!!!!!!!!!!!!!
0 0
Blighless X0MARI0X
10/17/2016 6:47 PM
Lost City
0 0
Edgar chinguilingui
10/17/2016 4:22 PM
Explotatorium (Plague)
la ironia a full
0 0
manti mantiman
10/17/2016 4:02 PM
Armor Outpost
love this game
3 0
Ian sandrainthesun32
10/17/2016 3:48 PM
Stranded Ship (Plague)
how to beat anything. JUMP HIGH USE VAT JUMP HIGHER.. THEN... RAIN POTIONS AND JUSTICE!!!!!!!!!!!!!!
0 0
DJZ DJZ1920
10/17/2016 3:30 PM
Plains (Plague)
just started playing plague of shadows and its awesome!!!
5 0
Skizz Linked117
10/17/2016 3:27 PM
Village
1 0
Ian sandrainthesun32
10/17/2016 3:21 PM
Stranded Ship (Plague)
wut r da cheats??
2 1
Ian sandrainthesun32
10/17/2016 3:11 PM
Village (Plague)
dear diary. the machine is going niceley. doc says it will work with only x amont of esence! -Brute
1 0
Ian sandrainthesun32
10/17/2016 3:06 PM
Clockwork Tower (Plague)
BARLEY MADE IT! BOSS HAZ MECH, i knew it but hey
1 0
Ian sandrainthesun32
10/17/2016 2:50 PM
Clockwork Tower (Plague)
not really. true though!!
0 0
Ian sandrainthesun32
10/17/2016 2:48 PM
Clockwork Tower (Plague)
chester at the end o room!
0 0
Ian sandrainthesun32
10/17/2016 2:45 PM
Clockwork Tower (Plague)
thanks for the vat tip dude!
1 0
nick tiff0817
10/17/2016 2:24 PM
Knuckler's Quarry
' door knight ' fine its tacos for breakfeast day ' stupid knight ' hahha thats tomarrow !!!!!!!!
1 0
Skizz Linked117
10/17/2016 2:22 PM
Clockwork Tower
0 0
nick tiff0817
10/17/2016 2:19 PM
Knuckler's Quarry
' door knight ' its time for you to go home ... ' stupid knight ' no! never i hate you door ....
0 0
nick tiff0817
10/17/2016 2:17 PM
Knuckler's Quarry
' minoin knight ' her that banging on the ... ' door knight ' hi its me door knight i am .....
1 0
nick tiff0817
10/17/2016 2:15 PM
Knuckler's Quarry
' minoin ' see its shovel knight ' king knight uhh its stupid knight ' stupid knight ' yes what ????
0 0
nick tiff0817
10/17/2016 2:14 PM
Knuckler's Quarry
' king knight ' eh i said no more google !! it doesn,t .... ' stupid knight ' halt i will kill you
0 0
nick tiff0817
10/17/2016 2:11 PM
Knuckler's Quarry
' king knight ' who is this knight with a shovel ' minoin knight ' idk i just looked him up google
0 0
Ian sandrainthesun32
10/17/2016 2:08 PM
Village (Plague)
Brute mole log- when i go digging j normaly walkinto plauge palls place.. he dances with himself.
3 0
Ian sandrainthesun32
10/17/2016 1:54 PM
Lost City (Plague)
because ur tips i won first time! WHEEEEEEEEEWW
0 0
Ian sandrainthesun32
10/17/2016 1:51 PM
Lost City (Plague)
big bombs help for hid prison attack!
3 0
Ian sandrainthesun32
10/17/2016 1:51 PM
Lost City (Plague)
thanks for tips! heres mine! DONT DIE :|
2 0
Kid LinkII 64DPKART
10/17/2016 1:51 PM
The Lich Yard
PREPARE TO TASTE JUSTICE! BUTT JUSTICE! I just love cheats!
3 0
Ian sandrainthesun32
10/17/2016 1:45 PM
Lost City (Plague)
whenever u fall becaus u dont have wifi
1 0
Ian sandrainthesun32
10/17/2016 1:42 PM
Lost City (Plague)
dont u lkve it whenever you can jump and burst threw all levels? EXPESIALY DIS ONE(hint) use float!!
1 0
Ian sandrainthesun32
10/17/2016 1:37 PM
Lost City (Plague)
hai from me and my fellow brute moles!
1 0
Ian sandrainthesun32
10/17/2016 1:36 PM
Lost City (Plague)
oi thanks dude! ive been useing compact bombs so im good right?
0 0
Nate Reva1ations1313
10/17/2016 8:55 AM
Tower of Fate: Ascent
0 0
Skizz Linked117
10/16/2016 6:53 PM
Armor Outpost
3 0
Blighless X0MARI0X
10/16/2016 6:48 PM
Iron Whale
i have no choice but to dance with him
3 0
tchula tchulanguero
10/16/2016 6:32 PM
Encuentro - Baz
:D
0 0
josh joshb2009
10/16/2016 5:53 PM
Clockwork Tower
boooooooo
7 0
Carter weegie214
10/16/2016 5:40 PM
Lost City
eh what do i do
1 0
Dalton legodalton1234
10/16/2016 4:15 PM
Troupple Pond (Plague)
i dont know what i am doing now
3 2
Blank Wiinner
10/16/2016 3:56 PM
Flying Machine
fitting that ths difficulty spike has so many spikes
0 0
Gus speedygust
10/16/2016 3:54 PM
Flying Machine
PHASE LOCKET JUKES!!
1 0
Tido tido05
10/16/2016 3:06 PM
Pridemoor Keep (Plague)
this game is so cooooool!!!!
2 0
joel harlin0303
10/16/2016 1:59 PM
Armor Outpost
alas i die so many time thus far and i probably wont stop any time soon
4 0
exploding ezraflores
10/16/2016 12:52 PM
Plains
got ya
0 0
exploding ezraflores
10/16/2016 12:52 PM
Plains
he he its me vs you dark knight
0 0
landon landonmedrano
10/16/2016 12:17 PM
Lost City
very hard level
3 0
Shadow Peanut0411
10/16/2016 11:22 AM
Plains
Just played this game it is so good!
3 0
Eddie Eddie74
10/16/2016 10:37 AM
Shivering Sprint (Plague)
This was pretty easy honestly
1 0
Skizz Linked117
10/16/2016 10:36 AM
Explodatorium
0 0
seaney milesadillo
10/16/2016 10:30 AM
Plains
do a barrelroll
3 0
Ian sandrainthesun32
10/16/2016 10:13 AM
Troupple Pond (Plague)
sick moves bruh!
1 0
kush bearpom1611
10/16/2016 8:24 AM
Plains
1 0
yahia yahia2003
10/16/2016 8:01 AM
Plaines
lol
0 0
Blaze Burn1ngBlaze
10/16/2016 6:30 AM
Stranded Ship
I bet you really want a hot spring now... WELL TOO BAD.
1 0
Mini Pat Happiness78
10/15/2016 10:46 PM
Explodatorium
Amiibo shovil knight is WAAAAAAY Too over power powered!!
2 0
juju julian_4u
10/15/2016 8:00 PM
Flying Machine (Plague)
Propeller Knight defeated.(come on mona come back.)
0 0
juju julian_4u
10/15/2016 7:43 PM
Stranded Ship (Plague)
Polar Knight Defeated.(where`s mona)
0 0
juju julian_4u
10/15/2016 7:22 PM
Encounter - Phantom Striker (Plague)
Took down Phantom Striker HEE HEE HEE.( Did Mona Really Leave.Mona!!!!!!!!!)
0 0
juju julian_4u
10/15/2016 7:16 PM
Encounter - Black Knight (Plague)
Took Down Black Knight HEE HEE HEE.(Moana!!!!!!!!!!)
0 0
George purplehouse
10/15/2016 6:09 PM
Plains (Plague)
hi
1 0
ensar EnsarMaster
10/15/2016 5:17 PM
Plains
0 0
Billy billbrad
10/15/2016 4:28 PM
Plains
shovle entry one-as my quest to save the land begins i find myself being attaked by giant bugs wierd
2 0
DJ DOMGOTGAME
10/15/2016 4:08 PM
Plains
1 0
Xavier kyzlix
10/15/2016 3:48 PM
Plains (Plague)
0 0
Xavier kyzlix
10/15/2016 3:48 PM
Plains (Plague)
0 0
Aaron 914aaron
10/15/2016 2:08 PM
Village
3 0
aramis aramisvasilakos
10/15/2016 1:41 PM
Pridemoor Keep (Plague)
1 0
juju julian_4u
10/15/2016 1:34 PM
Armor Outpost (Plague)
took down the hat owner he got pwned
3 0
Skizz Linked117
10/15/2016 1:29 PM
Iron Whale
0 0
juju julian_4u
10/15/2016 1:27 PM
Encounter - Baz (Plague)
Took down baz he's my minion now plague knight rules
0 0
juju julian_4u
10/15/2016 1:19 PM
Lost City (Plague)
Beated Mole Knight And Took His Soul
0 0
juju julian_4u
10/15/2016 1:08 PM
Encounter - Reize (Plague)
im invincible with the cheat with plague knight
0 0
Ian sandrainthesun32
10/15/2016 12:43 PM
Lost City
it was af this moment he knew he messed up *breaks checkpoint*
0 0
Skizz Linked117
10/15/2016 12:41 PM
Pridemoor Keep
0 0
Skizz Linked117
10/15/2016 11:55 AM
Pridemoor Keep
0 0
Micoo Leonis522
10/15/2016 11:13 AM
Plains
2 0
Arrionn dustinator70
10/15/2016 10:44 AM
Hall of Champions
sooo booosssss
1 0
Skizz Linked117
10/15/2016 10:28 AM
Village
2 0
exploding ezraflores
10/15/2016 10:00 AM
Iron Whale (Plague)
yeah but im coming for you treasure knight
0 0
Nightmare… JackWilly1
10/15/2016 8:56 AM
Flying Machine
2 0
Alex Kidd! Nathan656
10/15/2016 8:39 AM
Encounter - Black Knight
TVSVUEIO
3 0
princess dragon45600
10/15/2016 7:47 AM
Iron Whale
0 0
princess dragon45600
10/15/2016 7:46 AM
Iron Whale
0 0
Nightmare… JackWilly1
10/15/2016 3:59 AM
Bonus - Iron Whale
3 0
Toasty bananamctoast
10/14/2016 7:46 PM
Flying Machine (Plague)
Who's driving this thing!!!!
1 0
Toasty bananamctoast
10/14/2016 7:41 PM
Flying Machine (Plague)
Using plague knight is so much harder!
1 1
princess dragon45600
10/14/2016 6:33 PM
Iron Whale
2 0
Katie Link4thewin_19
10/14/2016 5:39 PM
Armor Outpost
yyyymmmmmmmm
2 0
Hoomun XerosGamin
10/14/2016 5:06 PM
Plains
The first level is pretty difficult for me lalz
7 0
SplatSpark benm2b
10/14/2016 4:44 PM
Pridemoor Keep
Whats Up
0 0
landon landonmedrano
10/14/2016 4:32 PM
Lost City
this is easy
1 0
Sirex hero234
10/14/2016 3:57 PM
Pridemoor Keep
new game plus is easy so far...
0 0
Sirex hero234
10/14/2016 3:48 PM
Pridemoor Keep
new game plus.... kill me
2 0
jordannic jordannnic
10/14/2016 3:03 PM
Troupple Pond (Plague)
hello
2 0
isaacy Spidey775
10/14/2016 3:02 PM
Plains
0 0
☆★MASTER★☆ pickljuice
10/14/2016 2:53 PM
The Lich Yard (Plague)
2 0
Robert pizzza4ever
10/14/2016 2:13 PM
Pridemoor Keep
first level: THIS GAME IS SO EASY pridmour keep: THIS GAME IS SO HARD RAGE QUIT
0 0
exploding ezraflores
10/14/2016 1:45 PM
Tower of Fate: ???? (Plague)
encentress is hard with pk
0 0
Hack JazzyAleck399
10/14/2016 1:19 PM
Campiña
Be mi friend
4 0
Mr.Leo Gahoondy
10/14/2016 7:28 AM
Village
amazing
0 0
Robert pizzza4ever
10/14/2016 5:01 AM
Tower of Fate: ????
YAY INVISIBLE PARQOUR IM IN LOVE ALREADY
2 0
Robert pizzza4ever
10/14/2016 4:58 AM
Tower of Fate: ????
hero, your journey is over, NOW DO IMPOSSIBLE STUFF FOR THE LOLZ and the hero is like: YOLOOOOOOOO
1 0
Bob Sofatr0n
10/14/2016 4:26 AM
Plains
2 0
Bob Sofatr0n
10/14/2016 4:07 AM
Plains
0 0
edward edward-kun64
10/13/2016 11:02 PM
Charca Truchanzana
como consigo el pergamino musical de aqui?
7 1
edward edward-kun64
10/13/2016 10:07 PM
La Ciudad Perdida
0 0
Bob Sofatr0n
10/13/2016 7:24 PM
Plains
õöõųdzdzdzdžțdzdzdzdzdzdzdzdzDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDžDž
0 0
Bob Sofatr0n
10/13/2016 7:20 PM
Plains
0 0
Bob Sofatr0n
10/13/2016 7:15 PM
Plains
0 0
Trysten Dragonlegends315
10/13/2016 6:09 PM
Stranded Ship (Plague)
1 0
Haley Melancon86
10/13/2016 5:33 PM
Tower of Fate: Entrance
2 0
landon landonmedrano
10/13/2016 5:27 PM
Iron Whale
beat boss.. with cheats!!!
1 0
landon landonmedrano
10/13/2016 5:21 PM
Iron Whale
Hahahha i is using cheat codes
1 0
Mauricio angelinamrtnz1
10/13/2016 5:01 PM
Iron Whale
yes
0 0
JfWood catocat9001
10/13/2016 3:41 PM
The Lich Yard (Plague)
WELL THAT'S EMBARRASSING i died loads of times.
4 0
nico realistcchip9
10/13/2016 8:04 AM
The Lich Yard
So Hard!!
0 0
bobby bobbyray2005
10/12/2016 4:50 PM
The Lich Yard (Plague)
beat him first try
2 0
=Nørth= AuraSayain4
10/12/2016 3:53 PM
Tower of Fate: Ascent
Succ.
3 0
Lucky maddsteve8047
10/12/2016 3:45 PM
Plains
shovel knight is so hard ;-[!
0 0
Davydooder chinacat23
10/12/2016 3:41 PM
Hall of Champions
Hey I'm Grump...
1 0
bobby bobbyray2005
10/12/2016 1:04 PM
Tower of Fate: ???? (Plague)
wow i want dat
1 0
bobby bobbyray2005
10/12/2016 12:51 PM
Tower of Fate: Entrance (Plague)
i destroyed him to i exploded him i just kept pushing a and it beat him
0 0
bobby bobbyray2005
10/12/2016 12:47 PM
Tower of Fate: Entrance (Plague)
i destroy everything i touch
1 1
bobby bobbyray2005
10/12/2016 12:39 PM
Rematch: King Knight
is this even possible
1 0
Bonham MikeWestcott
10/12/2016 12:22 PM
Village
2 0
Salmon DatAintFalco73
10/12/2016 12:01 PM
Plains (Plague)
It's Plaguing time!
1 0
Haley Melancon86
10/12/2016 11:57 AM
Plains
1 0
bobby bobbyray2005
10/11/2016 10:16 PM
Iron Whale (Plague)
beat him first time with potions
2 0
bobby bobbyray2005
10/11/2016 9:59 PM
Iron Whale (Plague)
yay its totaly not a trap again
1 0
bobby bobbyray2005
10/11/2016 9:56 PM
Iron Whale (Plague)
is it just me or is plauge knight easier to play as
3 0
Cal Cal0196
10/11/2016 9:28 PM
Pridemoor Keep
0 0
Conman GameCon23
10/11/2016 4:42 PM
Plains
i cant beat dark knight hes so hard.
2 0
coolguy123 helpo159
10/11/2016 3:12 PM
Stranded Ship (Plague)
hi
4 0
ghjouhf'pl tthorn1981
10/11/2016 8:53 AM
Troupple Pond
flLA JDJSAQ HY
0 0
bobby bobbyray2005
10/11/2016 8:20 AM
Dirt Clod Dive
im stuuuuuuuck
2 3
Juz juz600
10/10/2016 7:26 PM
Tower of Fate: Entrance
sob hard!
2 0
Hay Hay kat1975
10/10/2016 6:57 PM
Forest of Phasing
Hi
2 0
Juz juz600
10/10/2016 5:35 PM
Clockwork Tower
winner!!!
0 0
Juz juz600
10/10/2016 5:30 PM
Clockwork Tower
never mind.
1 0
Juz juz600
10/10/2016 5:29 PM
Clockwork Tower
tinker knight is so easy!
1 0
bobby bobbyray2005
10/10/2016 3:20 PM
Plains (Plague)
i used the god mode cheat to beat the game and get this oh yhea im playing this one with x&butt
1 0
Salmon DatAintFalco73
10/10/2016 2:03 PM
Stranded Ship
Polar Knight was kinda hard but not too much.
0 0
Salmon DatAintFalco73
10/10/2016 11:46 AM
Encounter - Phantom Striker
Phantom Striker tho
1 0
Salmon DatAintFalco73
10/10/2016 11:43 AM
Flying Machine
This one was hard!
1 0
Salmon DatAintFalco73
10/10/2016 10:36 AM
Lost City
That was intense! o.o
0 0
Salmon DatAintFalco73
10/10/2016 9:06 AM
Explodatorium
It was crazy! A lot was going on.
0 0
Juz juz600
10/10/2016 8:20 AM
Encounter - Black Knight
beat black knight 1st try!
0 0
Juz juz600
10/10/2016 8:10 AM
Lost City
get wrecked mole knight!
1 0
Salmon DatAintFalco73
10/09/2016 9:03 PM
The Lich Yard
Just beat Specter Knight. He was awesome!
1 0
Salmon DatAintFalco73
10/09/2016 8:46 PM
Encounter - Plains
I love this game!
3 0
Salmon DatAintFalco73
10/09/2016 8:41 PM
Pridemoor Keep
Easy, can't expect much from a first boss.
0 0
STT Kasim OmegaSoldierX
10/09/2016 6:31 PM
Explodatorium
I am loving the amiibo right now!
1 0
Ross emilyross73
10/09/2016 6:04 PM
Pridemoor Keep
i love this game!!!!
2 0
Runboy2007 Runboy2007
10/09/2016 5:58 PM
Plains
nice game for nintendo
1 0
Alex Allav866
10/09/2016 5:50 PM
Encounter - Phantom Striker
What a joke. Reize was harder than that!
0 0
Plague <:= vitri0l
10/09/2016 5:42 PM
Armor Outpost (Plague)
pERCY WHY
3 0
Nathan just4kids
10/09/2016 5:40 PM
Pridemoor Keep
OMG!!! Stupid Hard!!!!!@
0 0
bobby bobbyray2005
10/09/2016 5:18 PM
Flying Machine
at least this level isnt as hard as tinker knight
0 0
bobby bobbyray2005
10/09/2016 5:00 PM
Encounter - Phantom Striker
its zeus
0 0
Alex Allav866
10/09/2016 4:31 PM
Lost City
Still don't get why that last crack in the ceiling doesn't drip lava...
1 1
Ed^ Erick152
10/09/2016 4:27 PM
Villa
Mona y pleague knight
1 0
Alex Allav866
10/09/2016 4:25 PM
Troupple Pond
5 0
bobby bobbyray2005
10/09/2016 4:21 PM
Clockwork Tower
wow his true form is big i already knew that to
1 0
Alex Allav866
10/09/2016 4:10 PM
Hall of Champions
Issat JonTron?!
1 0
Alex Allav866
10/09/2016 3:59 PM
Hall of Champions
Egoraptor's not the only celebrity here, guys... Matt from Super Best Friends is here, too!
2 0
bobby bobbyray2005
10/09/2016 3:55 PM
Clockwork Tower
im indiana jones
1 0
bobby bobbyray2005
10/09/2016 3:38 PM
Encounter - The Lich Yard
im playing with this code x&butt
3 0
John volcarona126
10/09/2016 3:37 PM
Plains
how do you play multiplayer
0 0
bobby bobbyray2005
10/09/2016 3:36 PM
Village
at the nearest wallmart to me the game is $11
5 1
Loghan loghanm
10/09/2016 3:36 PM
Clockwork Tower (Plague)
I ganna lose
0 0
bobby bobbyray2005
10/09/2016 3:33 PM
Village
yess give me food
1 0
bobby bobbyray2005
10/09/2016 3:30 PM
Lost City
he just came out o a wall and i acidently hit him
1 0
bobby bobbyray2005
10/09/2016 3:26 PM
Lost City
im at the boss
3 0
bobby bobbyray2005
10/09/2016 3:19 PM
Lost City
i fell in lava
0 0
bobby bobbyray2005
10/09/2016 3:13 PM
Encounter - Baz
the more you hit baz the more he cries after you beat him
5 0
bobby bobbyray2005
10/09/2016 2:59 PM
Encounter - Baz
im playing with a funny cheat
2 1
bobby bobbyray2005
10/09/2016 2:46 PM
Iron Whale
this game is hard
0 0
bobby bobbyray2005
10/09/2016 2:33 PM
Iron Whale
im not happy
1 0
bobby bobbyray2005
10/09/2016 2:31 PM
Iron Whale
sooo hardddd
3 0
Alex Allav866
10/09/2016 2:28 PM
The Lich Yard
Can't wait for Specter of Torment!
4 0
☆PíXéL☆ MusicGamer64
10/09/2016 2:25 PM
Flying Machine
infinidagger!
0 0
T-L ☆☆☆☆☆ Mamadou-Style
10/09/2016 1:22 PM
Plaines
ses difficile je te le fait pas dire
1 0
Will ^._.^ GreedoBaggins
10/09/2016 1:09 PM
Encounter - Baz
2 0
Plague <:= vitri0l
10/09/2016 10:11 AM
Hall of Champions (Plague)
beat them all on my first try lmao
1 0
Plague <:= vitri0l
10/09/2016 9:58 AM
Encounter - Reize (Plague)
Reize, that was horrid.
1 0
EdGe BoY skoogs
10/09/2016 9:36 AM
Iron Whale
to hard i lose my saniaty
2 0
Lauren Laurenpop21
10/09/2016 9:24 AM
Fleet Flight
When you didnt get the fleet potion in the campaign so you have no idea how it works
2 0
Lauren Laurenpop21
10/09/2016 9:14 AM
Dragon Chase Race
I thought there would be multiple dragons, not just one...
1 0
Will skywillb
10/09/2016 9:10 AM
Lost City
Looks like i'm the one who buried you.
1 0
Will skywillb
10/09/2016 9:02 AM
Lost City
Am I the only one who doesn't find mole city that hard?
2 0
nico realistcchip9
10/09/2016 8:52 AM
The Lich Yard
0 0
H Quack5
10/09/2016 7:04 AM
Plains
3 0
ghjouhf'pl tthorn1981
10/09/2016 6:28 AM
Pridemoor Keep
1 0
Paul Dragonite666
10/09/2016 5:35 AM
Plains
0 0
Mini Pat Happiness78
10/08/2016 9:57 PM
Tower of Fate: Ascent
Level Just Starts And What Do I See... Spikes... Spikes Everywhere...
3 1
Mini Pat Happiness78
10/08/2016 9:54 PM
Tower of Fate: Entrance
Is He... He Is Casting Meteors, HE IS CASTING METEORS!!
4 0
Vaughn5786 Vaughndondrix
10/08/2016 9:08 PM
Village
how doyouchange gear
2 1
Aidan lhesson17
10/08/2016 8:37 PM
Village
1 0
☆PíXéL☆ MusicGamer64
10/08/2016 8:15 PM
Knuckler's Quarry
Infinininandout burger!!
2 0
Juz juz600
10/08/2016 8:12 PM
Lost City
i just broke the checkpoint!!!!
0 0
Plague <:= vitri0l
10/08/2016 8:02 PM
Explodatorium (Plague)
Watch for rats! Exploding rats!
6 1
Plague <:= vitri0l
10/08/2016 7:39 PM
Troupple Pond (Plague)
Yep... Totally nothing here. No huge magic fish God or anything. All is well.
7 0
hobo ellsworthfamily4
10/08/2016 6:45 PM
Plains
skeletons are easy!
2 0
Sans spoodermenlol1
10/08/2016 6:24 PM
Lost City
3 0
Ash a-traingamer
10/08/2016 5:15 PM
Hall of Champions
1 0
Ash a-traingamer
10/08/2016 5:14 PM
Hall of Champions
2 0
Lauren Laurenpop21
10/08/2016 2:31 PM
Explodatorium
You Died!Want to share your thoughts on miiverse?
1 0
jess jessemagoon
10/08/2016 2:28 PM
Plains
I rlly like this game.
0 0
bobby bobbyray2005
10/08/2016 2:12 PM
Lost City
i feel like my avatar
1 0
icebear43 loveamiboyay1562
10/08/2016 2:09 PM
The Lich Yard (Plague)
the music is really hard to find
0 0
bobby bobbyray2005
10/08/2016 2:05 PM
Lost City
i keep dieing
0 0
Phoenix stevie3947
10/08/2016 1:39 PM
Plains
THIS IS ME
4 0
Phoenix stevie3947
10/08/2016 1:38 PM
Plains
RILIC MAN
0 0
Phoenix stevie3947
10/08/2016 1:37 PM
Plains
I'm THE REAL KING
0 0
Plague <:= vitri0l
10/08/2016 11:33 AM
shortcut?
With gold armour you land perfectly! But in plague of shadow with the gold cloak you fall... CLUMSY!
3 0
Ethan EthanDS2008
10/08/2016 11:20 AM
Tower of Fate: Entrance
2 0
tasha tashamonkey
10/08/2016 11:12 AM
Plains
0 0
tasha tashamonkey
10/08/2016 11:09 AM
Plains
this is my first time playing
1 0
Colten CeeKay12
10/08/2016 11:03 AM
Armor Outpost
Just spam fire wand inbetween attacks. EZ
2 1
Jaysun Smashfan64
10/08/2016 10:39 AM
Encounter - Baz
Sorry Matt- I mean Baz.
0 0
Plague <:= vitri0l
10/08/2016 10:34 AM
Flying Machine
There's lots of rats! (Pitter Pat!)
1 0
Jaysun Smashfan64
10/08/2016 10:31 AM
Explodatorium
Urrrg... hardest boss yet. Watch his pattern, it's chaotic.
0 0
jefferson jeffersonRad
10/08/2016 10:25 AM
Flying Machine
i can't beet this level
0 0
suess HouseOfLernedDrs
10/08/2016 9:45 AM
Village
just started playing for 15$
7 1
Zach Zachary-Da-Boss1
10/08/2016 8:13 AM
Pridemoor Keep
easssy peepo
0 0
Dad JonesFamilyMN
10/08/2016 8:09 AM
Plains
If you beat the game as shovel knight than you get Shovel Knight Plague Of Shadows!!!
0 0
Juz juz600
10/08/2016 7:39 AM
Explodatorium
so hard!!!
2 0
Fallon joannosha
10/08/2016 7:11 AM
Stranded Ship
STUIDID ICE!
3 1
coolguy123 helpo159
10/08/2016 7:07 AM
Tower of Fate: ????
STUCK
2 0
Mike Sonic345232
10/08/2016 5:58 AM
The Lich Yard
specter knight is tough!
3 0
gmoney mario9656
10/08/2016 12:06 AM
Clockwork Tower
did anybody else think of game grumps when doing the room that requires the gear to get the music?:3
0 0
Vaughn5786 Vaughndondrix
10/07/2016 11:25 PM
Pridemoor Keep
the best
1 0
hi devonjosephs
10/07/2016 10:18 PM
Tower of Fate: Ascent
OMG! tower of fate is so hard! ];
7 0
hi devonjosephs
10/07/2016 9:26 PM
Tower of Fate: Entrance
0 0
Plague <:= vitri0l
10/07/2016 8:21 PM
Clockwork Tower
wHA BUT HE WAS JUST A SMOL THING DSDHHSVBJFSSASDF
2 0
Alegueiror alegueiror
10/07/2016 8:03 PM
Explodatorium
0 0
bri greggk
10/07/2016 7:57 PM
Iron Whale (Plague)
how do you get to that ladder?!
2 1
Justin Justinsheller
10/07/2016 5:49 PM
Hall of Champions (Plague)
BYE EGORAPTOR!
4 0
coolguy123 helpo159
10/07/2016 5:38 PM
Iron Whale (Plague)
Stuck
3 0
Q TheMightyOctopus
10/07/2016 5:30 PM
Pridemoor Keep
hi
0 0
dad edrclark
10/07/2016 4:59 PM
The Lich Yard
invincibility cheat code is bae
1 0
Dr. J Slyvern
10/07/2016 1:53 PM
Plains (Plague)
1 2
brody bro705
10/07/2016 12:37 PM
Armor Outpost
i just wanted a hat!
0 0
Kahuna kckahuna
10/07/2016 9:07 AM
Lost City
1 0
Hannah★♪ icerose17
10/07/2016 12:55 AM
Plains
0 0
David dgaliata
10/06/2016 6:44 PM
Forest of Phasing
2 0
Ichigo ichigo103
10/06/2016 5:16 PM
Plains
1 0
brody bro705
10/06/2016 4:54 PM
Iron Whale
try playing this on co-op... ITS SO HARD!!!
0 0
melissa minigamer2
10/06/2016 4:23 PM
Tower of Fate: Entrance
needs more purple
4 0
nicco pengwn4u
10/06/2016 3:16 PM
Forest of Phasing
Im a banana
2 0
melissa minigamer2
10/06/2016 11:51 AM
Stranded Ship
WAY to cold
0 0
melissa minigamer2
10/06/2016 11:21 AM
Clockwork Tower
you could say i dug up his plans
0 0
Jaysun Smashfan64
10/06/2016 8:50 AM
Plains
how calming.
2 0
Jaysun Smashfan64
10/06/2016 8:43 AM
Plains
Can't wait to finally play this!
1 0
Ross rosssydney
10/06/2016 6:55 AM
Tower of Fate: Ascent (Plague)
0 0
melissa minigamer2
10/05/2016 8:30 PM
Encounter - Reize
2anime4me
4 0
melissa minigamer2
10/05/2016 8:14 PM
Lost City
IT BUURRNS
0 0
Nick NickandNoah2015
10/05/2016 5:36 PM
Plains
i suk at dis game
0 0
Brent Brentinitis
10/05/2016 5:28 PM
Explodatorium
i am bRian Fleps!!!
1 0
Brent Brentinitis
10/05/2016 5:27 PM
Explodatorium
1 0
Bryan Mr.Cuddlypoo
10/05/2016 5:11 PM
Village
All hail the Troupple Lord!
1 0
Sirex hero234
10/05/2016 5:08 PM
Encounter - Phantom Striker
myhar
0 0
Sirex hero234
10/05/2016 5:06 PM
Stranded Ship
dank boss
0 0
Bryan Mr.Cuddlypoo
10/05/2016 4:40 PM
Knuckler's Quarry
Fear Thine bubble
1 0
Beef ahbeef
10/05/2016 2:47 PM
Armor Outpost
she hatt me
2 1
Beef ahbeef
10/05/2016 2:44 PM
Encounter - Reize
2 0
Blarry Blu TristanTheMage
10/05/2016 12:55 PM
Clockwork Tower
Well that escalated quickly.
0 0
Jack Jack101006
10/05/2016 12:37 PM
Flying Machine (Plague)
use cheat codes
1 0
,hxhjhj cl Kingdaddy_255
10/05/2016 11:08 AM
Pridemoor Keep
hello,
1 0
Evan themudkipgamer14
10/05/2016 2:44 AM
Plains (Plague)
I love playing as plague knight!
3 0
melissa minigamer2
10/04/2016 6:38 PM
Pridemoor Keep
way to easy xD
2 0
melissa minigamer2
10/04/2016 6:16 PM
The Lich Yard
FINALLY
0 0
melissa minigamer2
10/04/2016 6:04 PM
The Lich Yard
way to hard :P
0 0
Al RYUHAYABUSA5012
10/04/2016 5:53 PM
Iron Whale
Jesus this game is harder than i thought
1 0
mason tsenswampy12
10/04/2016 5:25 PM
The Lich Yard
FINALLY
2 0
mason tsenswampy12
10/04/2016 5:14 PM
Pridemoor Keep
0 0
mason tsenswampy12
10/04/2016 4:55 PM
Plains
0 0
mason tsenswampy12
10/04/2016 4:54 PM
Plains
0 0
Red Horse Austinredhorse15
10/04/2016 4:30 PM
Village
9 0
Sirex hero234
10/04/2016 3:16 PM
Explodatorium
nobody likes plague knight.
0 0
Sirex hero234
10/04/2016 3:01 PM
Explodatorium
murder.
1 0
Sirex hero234
10/04/2016 3:00 PM
Explodatorium
kill the level creator
1 0
Sirex hero234
10/04/2016 2:31 PM
Pridemoor Keep
BEADY RAT EYES
0 0
Sirex hero234
10/04/2016 2:21 PM
The Lich Yard
Spooky, but i made it!
0 0
Vulenhjir jamiphil
10/04/2016 12:51 PM
Explodatorium (Plague)
i hate the rats i should fire them
7 0
josh fluffybabywa
10/04/2016 11:40 AM
Iron Whale
THE FISH IS SO HARD !
0 0
Qasz ulises_qasz
10/03/2016 8:29 PM
Fortaleza del Orgullo
no soy fan de los 8bits pero esta bueno
2 0
Rodrigo rodrigolink
10/03/2016 7:20 PM
Ballena de Hierro
Me esta encantando el juego
2 0
BOB mdgtr2002
10/03/2016 4:14 PM
Explodatorium
Ds mk me sd.
1 0
Shean HiddenDarkness5
10/03/2016 2:50 PM
Clockwork Tower
Every single level has its portions that cause pure rage within you, this is one of those portions
3 0
Shean HiddenDarkness5
10/03/2016 1:56 PM
Flying Machine
I started with 6000+ gold, Im at 71 now and Im still in the same spot... *anger intesifies*
3 0
Shean HiddenDarkness5
10/03/2016 1:53 PM
Flying Machine
This is infuriating...
1 0
Brandon idrnkyrmilkshake
10/03/2016 1:52 PM
Armor Outpost
i like dis game
6 0
Shean HiddenDarkness5
10/03/2016 1:52 PM
Flying Machine
This is infuriating...
0 0
Shean HiddenDarkness5
10/03/2016 1:44 PM
Flying Machine
The most intimidating but easy part of the whole game
0 0
Shean HiddenDarkness5
10/03/2016 12:47 PM
Armor Outpost
who else saw that catfish shovel knight?
9 0
Shean HiddenDarkness5
10/03/2016 12:43 PM
Iron Whale
Now I can be as avarice as I want to be! *nothing was learned*
0 0
Shean HiddenDarkness5
10/03/2016 12:38 PM
Iron Whale
“You died! Want to share your thoughts on Miiverse?” *frustration building*
0 0
Shean HiddenDarkness5
10/03/2016 11:43 AM
Explodatorium
Whoa, now that was a lot of explosions
0 0
xStatic BIGHEATON6
10/03/2016 11:27 AM
Tower of Fate: Ascent
DARK KNIGHT: I WARNED YOU TO STAY BACK MY REACTION.... SANS MODE ACTIVATED
2 1
Justin Justinsheller
10/03/2016 11:23 AM
Explodatorium
That was really fun!
0 0
RhombusGod rhombusgod
10/03/2016 10:14 AM
Pridemoor Keep
Oh hey. neat
0 0
RhombusGod rhombusgod
10/03/2016 8:31 AM
Plains
Check out me custom knight
2 0
Justin Justinsheller
10/03/2016 6:26 AM
Lost City
Suck it Mole Knight!
0 0
Justin Justinsheller
10/03/2016 5:32 AM
Iron Whale
Finally beat him!
3 0
Justin Justinsheller
10/03/2016 5:16 AM
Iron Whale
You can pogo on the chest.
2 0
aziz Andya100
10/03/2016 4:32 AM
Plains
0 0
karina KARINACID
10/02/2016 7:40 PM
Fortaleza del Orgullo
tomala king kingt
2 0
Ethan winterhands
10/02/2016 7:36 PM
Lost City
getting really hype for Specter of Darkness!
1 0
karina KARINACID
10/02/2016 7:31 PM
Campiña
no hay multijugador
5 0
Sonic SonicSweeps
10/02/2016 6:58 PM
Stranded Ship
lets get it!! that background music tho lol
1 0
Trevor trekewi
10/02/2016 5:35 PM
The Lich Yard
memes
2 0
tony mrflufikins17
10/02/2016 5:17 PM
The Lich Yard
poh@
0 0
Shean HiddenDarkness5
10/02/2016 5:13 PM
Village
Laughs at your mighty shovel, stills calls you a warrior
2 0
Shean HiddenDarkness5
10/02/2016 5:06 PM
Plains
0 0
jack dad2313
10/02/2016 3:48 PM
Plains
shild knight helps you beat the final boss... oh yeah... spoliers
1 1
jack dad2313
10/02/2016 3:44 PM
Plains
much fun
1 0
Plague <:= vitri0l
10/02/2016 2:24 PM
Iron Whale
tfw you're ready to pay thousands for a single stupid relic and then wHA THERE'S A HUGE FISH
2 0
Sonkles s24n18c2
10/02/2016 12:48 PM
Plains
I really would love if shovel knight could travel to the future, where he meets megaman an team up!
2 0
turtle nike234
10/02/2016 12:33 PM
Troupple Pond
1 0
trayaurus Tree_Man_Dude
10/02/2016 12:28 PM
Plains
avdfxzfFttTfhtfdfsyyyuuitdedfhuX Fgtgiyhhjgyjuygyuuyyhytuyhghijhjikyututuhhghhthhghnbhhygygunytrhrmb
0 0
mason tsenswampy12
10/02/2016 12:10 PM
Plains
you can deflect the purple fireball thingies back to black knight by hitting them
0 0
turtle nike234
10/02/2016 12:09 PM
Plains
0 0
mason tsenswampy12
10/02/2016 12:08 PM
Plains
2 0
trayaurus Tree_Man_Dude
10/02/2016 12:01 PM
The Lich Yard
does anybody have any tip-top tips cause i don't know any.
0 0
Nathanael NStar3000
10/02/2016 11:53 AM
Troupple Pond
if you fish in the troupple kings pond while he is out you get TONS of apples and the #1 time u gt ♪
2 0
Nathanael NStar3000
10/02/2016 11:48 AM
Troupple Pond
Troupple King
1 0
Haley Melancon86
10/02/2016 11:47 AM
The Lich Yard
0 0
NBOY nboyoh
10/02/2016 11:43 AM
The Lich Yard
jjnjc?
0 0
Nathanael NStar3000
10/02/2016 11:04 AM
The Lich Yard
fighting specter knight is so HARD i wish he would just DIE already!
0 0
trayaurus Tree_Man_Dude
10/02/2016 10:54 AM
Pridemoor Keep
could someone tell me what shovel knight armor is made out of. (if you know what it is.)
0 0
? YupItsThatGuy
10/02/2016 10:26 AM
Armor Outpost
why does everyone want money yall broke af
3 0
? YupItsThatGuy
10/02/2016 10:24 AM
Explodatorium
pro tip: use about 9999999 fire blasts
0 0
? YupItsThatGuy
10/02/2016 9:54 AM
Explodatorium
DIOS MIO
2 0
? YupItsThatGuy
10/02/2016 9:54 AM
Explodatorium
down the rabbit hole
0 0
E Toaste_Strudel
10/02/2016 9:22 AM
Plains
2 0
E Toaste_Strudel
10/02/2016 8:49 AM
Plains
2 0
turtle nike234
10/02/2016 7:42 AM
Pridemoor Keep (Plague)
0 0
turtle nike234
10/02/2016 7:36 AM
Village (Plague)
2 0
turtle nike234
10/02/2016 7:10 AM
Plains
0 0
midget LOGIYOGIPI
10/02/2016 7:06 AM
The Lich Yard
so hard
1 0
casey wyattjriggs
10/02/2016 4:33 AM
The Lich Yard (Plague)
y'know, after being reunited with shield knight, you'd think plague knight would be easier.
6 0
MarioBrian SuperBrianMario
10/01/2016 11:04 PM
Explodatorium
I just went crazy with fire blasts. That seemed to work.
6 0
Izekial Izekial4427
10/01/2016 8:57 PM
Cog Bounce Chaos
WHY WAS THIS CHALLENGE MADE?!?! Who cares gg ;P
1 0
? YupItsThatGuy
10/01/2016 8:29 PM
Explodatorium
whoever made this level wants to see people suffer
2 0
leo joeblow5150
10/01/2016 7:49 PM
Explodatorium
I SUCK AT THIS GAME
2 0
Adam SmileyMan43
10/01/2016 6:47 PM
Village
Lost my fire wand
1 0
key torontonians
10/01/2016 4:19 PM
Village
This knight is rude.A shovel is the most deadly weapon
7 0
Spray-Z Spray-Z
10/01/2016 3:03 PM
Troupple Pond
that was 2 minutes stolen from my life
5 0
coolguy123 helpo159
10/01/2016 2:01 PM
Explodatorium (Plague)
I HATE rats
2 0
erik erock25622
10/01/2016 12:35 PM
The Lich Yard
this game is amazin
1 0
landon998 landon998
10/01/2016 11:35 AM
Campiña
reciénempeze
2 1
Frankie thechief921
10/01/2016 11:31 AM
Explodatorium
A lot of people say plague knight is hard, but just have red trouple juice and ur fine
0 0
sonic sonichernandez
10/01/2016 11:28 AM
Lost City
mole knight was not that hard
0 0
Mr.Leo Gahoondy
10/01/2016 11:11 AM
Village
best game ever
4 0
Ethan ETdarkslayer
10/01/2016 10:28 AM
Explodatorium (Plague)
whaaaaaat????
2 0
ellyot Mario4320
10/01/2016 10:15 AM
Clockwork Tower
WOW that was too easy
0 0
SL$Leo myriamrojas25
10/01/2016 10:00 AM
The Lich Yard
3 0
ellyot Mario4320
10/01/2016 9:46 AM
Stranded Ship
this ispreety easy
0 0
mason tsenswampy12
10/01/2016 9:30 AM
The Lich Yard
1 0
mason tsenswampy12
10/01/2016 9:22 AM
Pridemoor Keep
FINALLY!!!!!!!!!!
0 0
Clid~Calm brown211
10/01/2016 8:51 AM
Forest of Phasing
The joys of wielding a hammer.
0 0
ellyot Mario4320
10/01/2016 8:49 AM
Lost City
one hit away from killing me
0 0
Clid~Calm brown211
10/01/2016 8:45 AM
Flying Machine
Onward and upwards
2 0
ellyot Mario4320
10/01/2016 8:17 AM
Iron Whale
halfway awsome
0 0
ellyot Mario4320
10/01/2016 7:47 AM
Encounter - Reize
boom first try
0 0
seanson seanduffield
10/01/2016 7:43 AM
Plains
0 0
exploding ezraflores
10/01/2016 7:31 AM
Iron Whale
my gamepad always glitch
0 0
Jack Jack101006
10/01/2016 4:55 AM
The Lich Yard
he kill my when i was dead
0 0
Jack Jack101006
10/01/2016 4:53 AM
The Lich Yard
he killed my all i hade to do was hit him one more time
0 0
Jack Jack101006
10/01/2016 4:47 AM
The Lich Yard
0 0
Jim Mr.Hero13
10/01/2016 12:51 AM
Village
4 0
tora hector2tora
09/30/2016 11:02 PM
Plains
1 0
ojbrody omarg2045
09/30/2016 10:56 PM
Tower of Fate: Entrance
how do you guys get passed
1 1
josh fluffybabywa
09/30/2016 9:24 PM
Tower of Fate: Entrance
I HATE THIS LEVELLL
0 0
Matthew TheBunnysGame
09/30/2016 6:01 PM
Village
oh my dont get the golden armor its the warst one their is i got in because i did not look at it
3 0
Gonzaliito Taliito1
09/30/2016 5:43 PM
Villa
Muy entrete shovel knight saludos a todos... no olviden rescatar a shield knight jeje
4 1
R.I.P. MV Fuego10
09/30/2016 5:14 PM
Encounter - Baz
This timeline seems fo be if you leave Baz in plague of shadows
0 0
Vi royalservants
09/30/2016 5:09 PM
Iron Whale
can you save were you are in this game
2 0
b man brodywelch
09/30/2016 5:05 PM
Village
1 0
R.I.P. MV Fuego10
09/30/2016 5:00 PM
Encounter - Reize
Threw him off-screen with godmode constant war horn he thinks the good guy is bad and the bad,good
1 0
ellyot Mario4320
09/30/2016 4:45 PM
Explodatorium
that was the hardest boss ever
1 0
R.I.P. MV Fuego10
09/30/2016 4:27 PM
Rematch: Corrupted Essence
SHADOW MONA
1 0
R.I.P. MV Fuego10
09/30/2016 4:20 PM
Tower of Fate: ???? (Plague)
I beat it in less than a minute
1 0
Ripsaw Reaper0217
09/30/2016 4:13 PM
Pridemoor Keep
0 0
proman Bajenman
09/30/2016 2:56 PM
Pridemoor Keep
superpokemon get 3DS x
1 0
ChainChomp snailjohnson
09/30/2016 2:47 PM
Flying Machine
uuggg i hate the winds
3 0
Gavin blu3streak
09/30/2016 2:33 PM
Lost City
This game is awesome. This is the true successor to classic Mega Man 10/10
1 0
ChainChomp snailjohnson
09/30/2016 2:21 PM
Flying Machine
im poopy
0 0
zathaniel nzuranski
09/30/2016 1:38 PM
Tower of Fate: ???? (Plague)
Oh this is the best.
1 0
ellyot Mario4320
09/30/2016 8:38 AM
Pridemoor Keep
FINALLY!!! I did it
0 0
ellyot Mario4320
09/30/2016 7:10 AM
Plains
too easy
3 0
sebas abzol2003
09/30/2016 6:49 AM
Villa
holaguapo
1 0
Manuel Makashi805
09/30/2016 12:23 AM
Hall of Champions
Found Matt from tbfp but where is woolie?
2 0
ChainChomp snailjohnson
09/29/2016 7:48 PM
Armor Outpost
1 0
toxikksans toxikksans
09/29/2016 7:31 PM
Lost City
this game maks me angery
4 0
Zman Zman20
09/29/2016 7:00 PM
Pridemoor Keep
Beat king knight learned breaking checkpoints is bad the hard way
7 0
mason tsenswampy12
09/29/2016 6:41 PM
The Lich Yard
it wont let me exit to map
3 0
mason tsenswampy12
09/29/2016 6:31 PM
The Lich Yard
omg this game is so hard!!!!!!!
1 0
mason tsenswampy12
09/29/2016 6:12 PM
Plains
5 1
Roberto cacadepuerco
09/29/2016 4:55 PM
Charca Truchanzana (Plague)
como cosiges la última esplosion por favor
0 0
Wade platinumwade
09/28/2016 9:10 PM
Pridemoor Keep
0 0
Wade platinumwade
09/28/2016 9:07 PM
Pridemoor Keep
Custom Knights are the best knights I named mine Sprangledorf
0 0
Sonic SonicSweeps
09/28/2016 8:18 PM
Plains
lets gooo! lol
1 0
Danny fivefive5ive
09/28/2016 6:54 PM
Iron Whale
3 0
Redd ReddMcKnight
09/28/2016 6:32 PM
Lost City
Whoo! One try! I thought he'd be way worse!
1 0
Brian BriGuy200
09/28/2016 6:15 PM
Tower of Fate: Ascent
Freaking Polar Knight's spikes get me everytime
2 0
Clid~Calm brown211
09/28/2016 5:23 PM
Iron Whale
We shall prosper.
0 0
Journey pactty6
09/28/2016 3:49 PM
Lost City
Wow. He was tough yet i still beat him
0 0
GioLord HaloGuy2005
09/28/2016 3:35 PM
Explodatorium
0 0
Josh Jco910
09/28/2016 7:40 AM
Plains (Plague)
i used a cheat lol
1 0
frank francis5265
09/27/2016 7:08 PM
Plains
cool
2 0
Generic yolomaster768
09/27/2016 3:25 PM
Log Toggler
Kachow!
2 0
Mathyaz Mathyaz
09/27/2016 1:34 PM
Tower of Fate: Entrance
One word: anchors.
1 0
cosmic owl shamus2007
09/27/2016 1:20 PM
Armor Outpost (Plague)
how do i get in
2 0
Diesel dieselwerk
09/27/2016 12:02 PM
The Lich Yard
Don't trust everything you see!
0 0
Jedi Boss1130
09/27/2016 11:30 AM
Plains
Beat first level. Sweet!
1 0
Jedi Boss1130
09/27/2016 11:15 AM
Plains
Finally picked up Shovel Knight. Loving it.
3 0
Diesel dieselwerk
09/27/2016 7:06 AM
The Lich Yard
0 0
Vampbionie sur-Lukus-1
09/26/2016 2:51 PM
Plains
1 0
f2m gthonan
09/26/2016 2:31 PM
Tower of Fate: Entrance
1 0
Mathyaz Mathyaz
09/26/2016 8:18 AM
Flying Machine
That rose was so... needed.
2 0
Mathyaz Mathyaz
09/26/2016 8:08 AM
Flying Machine
If you're reading this... You're awesome!!
2 0
Mathyaz Mathyaz
09/26/2016 8:05 AM
Flying Machine
Went in with 3000+ gold, ended with less than 1500. Whoops.
1 0
ojbrody omarg2045
09/25/2016 9:07 PM
The Lich Yard
this guys hard
1 0
Brett diabloanid12
09/25/2016 7:53 PM
Tower of Fate: Ascent
Ive wasted 7 hours of my day tryin to beat this on the hardest difficulty.what am i doin with mylife
2 1
Carter randomness99
09/25/2016 7:36 PM
Pridemoor Keep
i played this and beat it on my pc and now i finally have it on my wii u
1 0
i8bacon yoshisweg64
09/25/2016 7:02 PM
Village (Plague)
hit the walls!
6 0
i8bacon yoshisweg64
09/25/2016 6:53 PM
Iron Whale (Plague)
this feels broken!
4 0
f2m gthonan
09/25/2016 6:29 PM
Forest of Phasing
in useing the everything code YAY
1 0
f2m gthonan
09/25/2016 6:04 PM
Lost City
4 0
f2m gthonan
09/25/2016 5:35 PM
Pridemoor Keep
1 0
Nesty 3 Nesty3
09/25/2016 2:38 PM
Villa
roteconmipober
1 0
Nesty 3 Nesty3
09/25/2016 2:28 PM
Finca de Liches
0 0
Nesty 3 Nesty3
09/25/2016 2:23 PM
Finca de Liches
0 0
racing nic Nicman56
09/25/2016 2:18 PM
Tower of Fate: ????
RAGEING
3 0
Nesty 3 Nesty3
09/25/2016 2:17 PM
Finca de Liches
0 0
☆d.va☆ Zachariie
09/25/2016 12:18 PM
Explodatorium
1 0
☆d.va☆ Zachariie
09/25/2016 11:39 AM
The Lich Yard
1 0
kingdom kingdomMark
09/25/2016 11:10 AM
Village (Plague)
hello
0 0
nick dhortaridis
09/25/2016 10:46 AM
Pridemoor Keep
I just beat the king knight as my second level. It was tough but i did it
0 0
ASH1256 ASHanthony1313
09/25/2016 10:28 AM
Plains
so the adventure being's!
0 0
NBOY nboyoh
09/25/2016 9:44 AM
Plains
0 0
Shatsi Zwanty
09/25/2016 8:40 AM
Finca de Liches
mate Specter Knight a la primera
1 1
i erasemii axel26bwm
09/25/2016 8:27 AM
Village
i have god mode!!!
5 0
gussy omega-bly
09/25/2016 7:38 AM
Villa
como consigo el dlc de plague knight?
1 2
QOPED RonnieShowstoppr
09/25/2016 6:53 AM
Pridemoor Keep
i beat king kight with the trouple dance
3 0
jack 1020 franco415
09/25/2016 4:24 AM
Armor Outpost
TRUFFLE TRUFFLE DADADADATTTTTT
6 0
jack 1020 franco415
09/25/2016 4:20 AM
Armor Outpost
FINAL ATACK AND I DIE
0 0
Ava Purrsonal
09/24/2016 8:20 PM
Plains
Just unlocked the 'butt' cheat.
3 0
Sabine Nabexis
09/24/2016 7:15 PM
Pridemoor Keep
1 0
Maggie Blond_Chick2201
09/24/2016 5:49 PM
Armor Outpost
just got golden armor LUVZIT
3 0
Prometheus SuperNami
09/24/2016 5:07 PM
Flying Machine
I haven't played videogames in quite some time. I especially forgot how much fun Shovel Knight was!
1 0
Maggie Blond_Chick2201
09/24/2016 5:00 PM
Lost City
two tries to kill
0 0
Maggie Blond_Chick2201
09/24/2016 4:37 PM
Village
hidden pink gem above hidden music sheet
3 0
Maggie Blond_Chick2201
09/24/2016 4:33 PM
Pridemoor Keep
he is ez
0 0
grammy grampy1959
09/24/2016 4:01 PM
Explodatorium
0 0
Kid Ink SplatedTomato116
09/24/2016 1:41 PM
Pridemoor Keep
yas! I beat King Knight! He was a fool to stand up to Justice!
1 0
Maggie Blond_Chick2201
09/24/2016 12:00 PM
Troupple Pond
ughhh the dance takes so much time
2 0
Maggie Blond_Chick2201
09/24/2016 11:34 AM
Plains
im a returning player from a different profile.
0 0
MEGAMUFFIN MEGAMUFFIN1738
09/24/2016 10:14 AM
Lost City
POTATOES
0 0
MEGAMUFFIN MEGAMUFFIN1738
09/24/2016 10:07 AM
Lost City
2 0
cm lukejames6
09/24/2016 9:28 AM
The Lich Yard
beat
4 0
R.I.P. MV Fuego10
09/24/2016 9:28 AM
Tower of Fate: Ascent
I AM GODMODED I CAN KILL YOU ALL
4 1
maze ItzMasaru
09/24/2016 8:32 AM
Plains
mzae
0 0
Jack jackroman
09/24/2016 7:20 AM
Village
Did You Know Kratos Is In The PS4 Version
6 0
Jack jackroman
09/24/2016 6:54 AM
Pridemoor Keep
too hard
1 0
R.I.P. MV Fuego10
09/24/2016 6:44 AM
Lost City (Plague)
Do not use orbit case
1 0
R.I.P. MV Fuego10
09/24/2016 6:26 AM
Lost City (Plague)
Hi shovel knight will give u game over noe
3 0
Joseph SpyrothekidRS
09/24/2016 6:00 AM
Pridemoor Keep
king knight's stage is a fat difficulty spike. >:(
0 0
David chronister4673
09/24/2016 4:58 AM
Lost City
SO COOL
0 0
David chronister4673
09/24/2016 4:47 AM
Encounter - Reize
I am rich!!!!!!!!!!!!!!!!!!!!!!!!!!!
0 0
Alu Alu1987
09/23/2016 9:07 PM
Campiña
porfin lo tengo en wiiu luego de disfrutarlo en portatil... y el amiibo hace disfrutarlo de a dos!
3 0
Rubén PhoenixGames34
09/23/2016 8:28 PM
Village
SO RED
1 0
Splatooner mvalviar
09/23/2016 8:23 PM
Forest of Fishing (Plague)
let me uot of this gate! >:(
3 0
R.I.P. MV Fuego10
09/23/2016 8:22 PM
Explodatorium (Plague)
Leech Liquid +Standing on edge and jump when hs is yeti and remote-controlled orbital cluster bombs
4 1
Splatooner mvalviar
09/23/2016 8:19 PM
Forest of Fishing (Plague)
4 0
R.I.P. MV Fuego10
09/23/2016 8:18 PM
Explodatorium (Plague)
Hi Male Magici--AHH
1 0
Splatooner mvalviar
09/23/2016 7:51 PM
Stranded Ship (Plague)
1 0
R.I.P. MV Fuego10
09/23/2016 7:02 PM
Iron Whale (Plague)
Hey guys i defeated the boss!Should i post about it on miiverse?
1 0
R.I.P. MV Fuego10
09/23/2016 7:00 PM
Iron Whale (Plague)
His battle theme reminds me of his stage theme
3 0
R.I.P. MV Fuego10
09/23/2016 6:36 PM
Iron Whale (Plague)
Easy when you are lil' plaguey here but is knight-mare with shovel knight
1 0
R.I.P. MV Fuego10
09/23/2016 6:31 PM
Iron Whale (Plague)
So many skellys on my prof.image
1 0
R.I.P. MV Fuego10
09/23/2016 5:52 PM
Village (Plague)
Look at the bookshelf,see anything familiar?Why,a book from Primedoor Keep,of course!
2 0
R.I.P. MV Fuego10
09/23/2016 5:24 PM
Pridemoor Keep (Plague)
1st
2 0
R.I.P. MV Fuego10
09/23/2016 5:12 PM
Pridemoor Keep (Plague)
Go LEFT!!!
2 0
R.I.P. MV Fuego10
09/23/2016 4:13 PM
The Lich Yard (Plague)
AHH SKELLYTON RUN
3 0
Golden goldenocelot
09/23/2016 2:41 PM
Village
I'm the slowest...
3 0
grammy grampy1959
09/23/2016 1:33 PM
The Lich Yard
dang it bobby
0 0
grammy grampy1959
09/23/2016 1:23 PM
The Lich Yard
am i the onli one who dosn't like this part
3 0
Dragon Dragin2007
09/23/2016 12:41 PM
Armor Outpost (Plague)
I'm a god so Mr. Hat cannot beat me
3 0
Dragon Dragin2007
09/23/2016 11:46 AM
Armor Outpost
I'm a god so MR. Hat cannot beat me
0 0
Dragon Dragin2007
09/23/2016 11:42 AM
Troupple Pond
I HATE THE TROUPLE KING
2 0
Dragon Dragin2007
09/23/2016 11:22 AM
Village
hhhhhheeeeeelllllp
2 0
Dragon Dragin2007
09/23/2016 11:14 AM
Encounter - Plains
I beat game plus
1 0
Dragon Dragin2007
09/23/2016 11:12 AM
Pridemoor Keep
I sent that mortal to hell
0 0
Dragon Dragin2007
09/23/2016 11:09 AM
Pridemoor Keep
die mortal
1 0
Caden cadenbear08
09/23/2016 10:28 AM
Pridemoor Keep
0 0
Caden cadenbear08
09/23/2016 10:20 AM
Pridemoor Keep
1 1
gerazz gerazz
09/22/2016 10:28 PM
Campiña
como es el multijugador
0 0
Splatooner mvalviar
09/22/2016 9:02 PM
Village (Plague)
YES I GOT THE GOLDEN CLOTH AND MASK JUST 8000 GOLD 100% COOL LOL! :D
3 0
Splatooner mvalviar
09/22/2016 8:24 PM
Village (Plague)
velvet ant vs tarantula hawk (male) what insect is the winner answer here______________________
1 0
brenden BrendenS2811
09/22/2016 7:59 PM
Tower of Fate: Entrance
1 0
Mason jestaylor
09/22/2016 7:11 PM
Plains
yay i beat level 1
4 0
Cyan LeilaMATOS
09/22/2016 6:28 PM
Torre del Hado: Entrada (Plague)
3 0
Splatooner mvalviar
09/22/2016 6:04 PM
Plains (Plague)
1 0
BT-Sans megalovania99
09/22/2016 3:56 PM
Armor Outpost
INFINADAGGER AWAY!!! dies HELLOOOOOOOOOOOOOOO I RETURN AGAIN BACK FOR A NOTHER INFINADAGGER ADVENTUR
8 1
Midnight prycewiiu
09/22/2016 3:41 PM
Stranded Ship
Easy
1 0
Lauren Laurenpop21
09/22/2016 2:36 PM
Tower of Fate: Entrance
I had 2000 something gold going into this level.Now i only have 469 and i havent even beat the level
3 0
Lauren Laurenpop21
09/22/2016 2:28 PM
Tower of Fate: Entrance
I want to break this checkpoint so bad, but i know i'll die later and regret everything i've done.
1 0
pollito saltshaker52
09/22/2016 1:52 PM
Troupple Pond
met tropule king
1 0
Splatooner mvalviar
09/21/2016 8:22 PM
Armor Outpost (Plague)
3 0
Mike Sonic345232
09/21/2016 6:58 PM
Pridemoor Keep
king knight is so hard!!!
1 0
Splatooner mvalviar
09/21/2016 6:55 PM
Encounter - Reize (Plague)
reize is good
1 0
Kael kdrson
09/21/2016 5:46 PM
Plains
2 0
Lauren Laurenpop21
09/21/2016 5:40 PM
Flying Machine
Going into this stage-4000 gold After reaching second to last checkpoint-977
2 0
Will skywillb
09/21/2016 5:09 PM
Clockwork Tower
Welp, at least i defeated him on the second try.
0 0
Will skywillb
09/21/2016 5:00 PM
Clockwork Tower
Holy cow that was hard!
1 0
Elba Ginón AlexSteinmann
09/21/2016 4:55 PM
The Lich Yard
ayyy lmao
0 0
Kollin osnoe1317
09/21/2016 1:26 PM
Armor Outpost
Fish head knight is so wierd #2playertroubles
4 0
venoct jayden3345
09/21/2016 9:35 AM
Lost City (Plague)
playing as plauge
4 0
charoll28 charoll28
09/20/2016 7:19 PM
Campiña
1 0
cool kid! nxs143
09/20/2016 5:50 PM
Lost City
Hint: This is a great level to get the knuckle under achievement. (look to the stages beginning)
2 0
Tyler doctorTfrenzy
09/20/2016 4:54 PM
Flying Machine
0 0
mc mcpipz_taco
09/20/2016 3:46 PM
Pridemoor Keep (Plague)
use the thing to do a thing
1 0
Mikey NapLajoie
09/20/2016 9:11 AM
Village (Plague)
great game- looking forward to specter knight dlc!
13 0
Ammon Light_Pork
09/19/2016 7:59 PM
Hall of Champions
I'm not so grump!
1 0
S3NATOR S3NATOR
09/19/2016 6:53 PM
Stranded Ship
8 0
Cyan LeilaMATOS
09/19/2016 12:24 PM
Torre del Hado: ????
7 0
Chepoc chepoc03
09/19/2016 10:41 AM
Tower of Fate: Entrance
Next update gonna be spoky
0 0